Godlike Productions - Discussion Forum
Users Online Now: 2,122 (Who's On?)Visitors Today: 1,058,504
Pageviews Today: 1,469,072Threads Today: 400Posts Today: 7,075
12:09 PM


Back to Forum
Back to Forum
Back to Thread
Back to Thread
REPLY TO THREAD
Subject Get in here Vax shills and debunk these studies and findings.
User Name
 
 
Font color:  Font:








In accordance with industry accepted best practices we ask that users limit their copy / paste of copyrighted material to the relevant portions of the article you wish to discuss and no more than 50% of the source material, provide a link back to the original article and provide your original comments / criticism in your post with the article.
Original Message Think again... The gene-therapy mRNA reprograms the cell to produce a viral component. It's a synthetic spike-protein sequenced in a lab by a computer and has multiple kill-points that will cause 100% mortality within 10 years for anyone who took it.

The PRION encoded in the spike-protein

The most deadly aspect of this kill-shot is the genetic sequence contains a 5 GxxxG prion motif which will be a slow-onset of neural degenerative diseases and already we are seeing a uptick in CJD or crutzfeild-jakobs disease in Phizer vaccinated patients. CJD is 100% fatal!

This has been confirmed by many people in the industry and you can also prove it yourself by running the synthetic gene sequence for this spike protein through PLAAC and the dip at 500 is the prion motif.

Here is the gene-sequence.
[link to www.uniprot.org (secure)]
>sp|P0DTC2|SPIKE_SARS2 Spike glycoprotein OS=Severe acute respiratory syndrome coronavirus 2 OX=2697049 GN=S PE=1 SV=1

MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGT​NGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWME​SEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINI​TRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTS​NFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYA​DSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGST​PCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKF​LPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGS​NVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTIS​VTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNF​SQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTIT​SGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVK​QLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGK​GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNC​DVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYE​QYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT

Here is PLAAC, copy and paste the gene-sequence run it for yourself and it spikes at 500 which is the prion.
[link to plaac.wi.mit.edu]

SARS-CoV-2 Prion-Like Domains in Spike Proteins Enable Higher Affinity to ACE2
[link to www.preprints.org (secure)]

This is why it caused Lewy Body disease in the Macaque monkey studies.
SARS-CoV-2 causes brain inflammation and induces Lewy body formation in macaques
[link to www.biorxiv.org (secure)]

A video on the Prion findings...


[link to www.bitchute.com (secure)]

It's catching some attention:
Scientist sounds alarm: COVID vaccines producing symptoms of Parkinson’s, other neurodegenerative disorders
[link to www.lifesitenews.com (secure)]

Here are a couple of scientific studies on the brain lesions this is causing ie ... real brain damage.

Acute transverse myelitis following SARS-CoV-2 vaccination: a case report and review of literature

[link to www.ncbi.nlm.nih.gov (secure)]

More studies showing vaccine causing brain lesions...!!!
COVID-19 mRNA vaccination leading to CNS inflammation: a case series
[link to www.ncbi.nlm.nih.gov (secure)]
The SPIKE-PROTEIN is part of the Sars-Cov-2 Pathology!

The second deadly aspect is that the spike-protein itself is toxic and part of the Sars-Cov-2 pathology meaning it causes inflammation. We know this from research on the spike-protein itself and it is the only part of the virus that binds to IL-8 proteins in the lung that causes inflammation.

Induction of IL-8 Release in Lung Cells via Activator Protein-1 by Recombinant Baculovirus Displaying Severe Acute Respiratory Syndrome-Coronavirus Spike Proteins
[link to www.jimmunol.org (secure)]

SARS-CoV-2 spike protein induces inflammation via TLR2-dependent activation of the NF-κB pathway
[link to pubmed.ncbi.nlm.nih.gov (secure)]

The novel coronavirus’ spike protein plays additional key role in illness
[link to www.salk.edu (secure)]

SARS-CoV-2 Spike Protein Impairs Endothelial Function via Downregulation of ACE 2
[link to www.ahajournals.org (secure)]

This leads to two specific areas where death or injury can occur:

Myocartitis - Inflammation of the Heart.
Encephlatitis - Inflammation of the brain.

The other problem is our own immune systems response to our cells causing an immune-response where the cell presenting the spike-protein triggers the killer T cells to attack and kill the cell. If too many cells die this triggers a platelet response forming clots. Thrombosis or micro-thrombosis becomes and issue and this leads to heart attacks and strokes.

This is where we have the deaths that appear within 14 days of the shots for those who get the clots and die.

Of course the final death-blow comes from ADE as we know this is causing ADE in the UK/Israel as it takes 6-9 months for that problem to occur. Another slow-onset problem of this soft kill weapon.

Not to mention the death of CB8 Killer T-Cells causing a type of auto-immune disorder.

How is this not a bioweapon designed to decimate the human population?

Oh wait, someone on the TV said safe and effective (without any human trials).

Welcome to the Vaccine Holocaust of 2021... thank-you for your participation in the greatest crime against humanity ever to take place in human history.
Pictures (click to insert)
5ahidingiamwithranttomatowtf
bsflagIdol1hfbumpyodayeahsure
banana2burnitafros226rockonredface
pigchefabductwhateverpeacecool2tounge
 | Next Page >>





GLP