AMERICA Denies The Command To Repent Again Destruction Comes | |
CELT1
(OP) User ID: 78677992 United States 03/27/2020 06:04 PM Report Abusive Post Report Copyright Violation | Repent Pray Then Help One Another... After Ye Sleep... Ye Shall Awaken Surrounded By Absolute Darkness... A Bitter Cold Reality... Ye Shall Remember What Ye Lost... A Body Of Christ An Old Clay Pot... A Chattering Of The Teeth Ye Onced Had... This Is Where Fear Begins... Again Is Their Anyone Out There? ... The Cleansing Continues... Watch The Democratic Controlled Areas... The Coup Is Wide... Democratic Party Of Socialist Commie Communist Traitors... The Chinese Biological Weapon Released Upon The World Is Real... Governors Telling Doctors How To Treat Patients?... These Aren't Leaders They're Tyrants Of Pure Evil... Media Spreading Bullshit To Fulfill Their Globalist Agenda... The Insurance Plan... Believe It Or Not... I Live In The Worst State In The Nation For Social Distancing... My County 3 Cases... A Church On Every Corner... God Fearing Town... I'm Surrounded By People That Love Jesus Christ... The Cleansing Continues... Last Edited by CELT1 on 03/27/2020 06:19 PM CELT1 |
CELT1
(OP) User ID: 78677992 United States 03/27/2020 09:17 PM Report Abusive Post Report Copyright Violation | Where's All The Trolls?... Make My Day... As I Shame Ye... Repent Pray Then Help One Another Or Stay Condemned... A Blessing Or A Curse?... I'm Tired Of The Bullshit... Judgement Day Has Arrived... What I Bless Stays... The Rest Shall Sleep After They Taste The Wrath Of GOD As A Lesson To The Ungodly... Last Edited by CELT1 on 03/27/2020 09:25 PM CELT1 |
CELT1
(OP) User ID: 78677992 United States 03/28/2020 08:10 AM Report Abusive Post Report Copyright Violation | Nevada Governor Steve Sisolack will go down in history as having blood on his hands for not allowing ZINC/HYDROXYCLOROQUINE/AZITHROMIACIN to be prescribed early on at first symptom CLINICAL diagnosis (without waiting days for test results). As does any state Governor who blocks hydroxycloroquine treatment along with ZINC and the antibiotic Zpack. Quoting: DeploraVision ™ I have an email in to Wayne Root for a pod cast or transcript of his interview with Dr. Zelenko today. The doctor who has now cured up to 650 patients with only one patient needing to be in ICU and ended up cured too. All of the cloroquine info is totally misunderstood, and that's what I took away from the interview. What kills the virus (and many more viruses) is ZINC. COVID19 has a protective shell around it that ZINC cannot permeate or penetrate. Hydroxychloroquine tears the COV19 'shell' to create a pathway for ZINC to enter the virus cell. That's all it does really, just kick the fucking door down so ZINC can enter the virus shell and kill it instantly. Azithromycin (Zpack) is just there to treat secondary infections that COV19 causes when it tears up and scars the lung tissue, and is more susceptible to bacterial infection on top of the viral damage. That's it. 1, 2, 3. ZINC kills the COV19 but needs a SWAT TEAM (Hydroxychloroquine) to break into the virus cell. The Zpack anti-biotic keeps the bacteria from further killing the patient, but ZINC is like weed-killer for COv19. The key to this treatment is at the very first day of symptoms the 3 part medicine cocktail should be given to the patient before they end up in the ER. This 3 drug cocktail knocks the corona dead within 5 days or so, but without it, a patient can stop breathing overnight on about the 10th day with a sudden spike in viral loads, and infection producing pneumonia . Once a patient is intubated on a ventilator in the ICU, the mortality rate will be 50% (even with zinc/chlorquine/zpack). The key is to give the 3medicineZinc cocktail at the first signs of symptoms BEFORE the test results come back. Its cheap and can be instantly mass produced without big pharma raping us with $10k pricing. Dr. Zelenko said in the interview today that he is in close contact with the White House, but I still don't hear that in the media or from POTUS directly. The Dr. up with Trump now in the press conferences is an idiot to not be speaking of Dr. Zelenco's findings with hundreds of patients at zero fatality rate. So, if Wayne Root can give out the link to today's interview, I will put it up here. He reads his emails and I've emailed Wayne in the past, so I'm sure I'll get a response eventually. ZINC/HYDROXYCLOROQUINE/AZITHROMIACIN is the cheapest, easiest mass produced cure that can be found, and proven to work with zero deaths. Big pharma wants to sell patients a $10,000 treatment with 'new drugs' that will drain your bank accounts and take years while millions of Americans die. The USA doesn't need 2 trillion $$ in pork and welfare; it just needs ZINC and two other cheap drugs. cheap, cheap, like $20 per American! My God, do they just want riots and more patient deaths, or can we just cure this with simple a simple vitamin ZINC and two other cheap, common drugs? If someone can find another interview or link from Dr Vladimir Zelenco, please embed it here. Meanwhile I'm chugging tonic water and ZINC and Vitamin C just to get pre-conditioned because Dr. Zelenco said that we all will eventually get COV19, and really must get it in order to develop human immunity to it. Meanwhile ZINC kills it, and you need the other two parts to KO the virus completely. BTW, Zinc is a vitamin. I just bought a crapload of Zinc after shopping 3 stores, I found it! This is Dr. Zelenco, but not the interview that explains the ZINC and why its the actual virus killer.. [link to www.youtube.com (secure)] Democratic Governors Keeping Doctors From Treating The Sick To Push A Political Point... These Are Not Leaders They're Tyrants Of Pure Evil... As I Said This Combo Works... CELT1 |
CELT1
(OP) User ID: 78677992 United States 03/28/2020 09:31 AM Report Abusive Post Report Copyright Violation | Pope Francis, in desolate St. Peter's Square, prays for end to coronavirus Pope Francis prayed for an end to the coronavirus pandemic on Friday in front of an empty St. Peter's Square, as Italy continues to remain one of the most impacted regions in the world. Speaking through the rain, Francis read from the Gospel during the hour-long ceremony and urged the world to view the crisis as a reminder of basic values. "My God’s blessing come down upon you as a consoling embrace,” Francis said from the steps of St. Peter's Basilica, where he normally draws tens of thousands of worshippers. “Lord, bless the world. Give health to our bodies and comfort our hearts.” [link to www.foxnews.com (secure)] So Much To Say About This... It Makes Me Smile And Cringe At The Same Time... And Old Saying... 16So they brought it, and He asked them, “Whose image is this? And whose inscription?” “Caesar’s,” they answered. 17Then Jesus told them, “Give to Caesar what is Caesar’s, and to God what is God’s.” And they marveled at Him. 18Then the Sadducees, who say there is no resurrection, came to Jesus and questioned Him:… A New Saying... Repent Pray Then Help One Another... SIMPLE The Silly Pope Prays Out In Public... It Was Said To Pray Behind Closed Doors... Give To Caesar What Is Caesar's... Give To God What He Wants... The Love Of His People And The Respect That He Deserves... Not A Damned Collection Plate... A Blessing Or A Curse... God Doesn't Listen To Sinners... The Cleansing Continues... I Just Answered The Silly popes Prayer... A Quote That Needs To Be Seen... remove this bigoted post now, you have no clue as to what the Catholic faith is about, what this blessing entailed and why it had to be public! He is the leader of a Billion Catholics, your ignorance is deafening. My Reply... Then Go Worship Him... ITALY... I Teach About YAH... Your Abba Himself... BIGOTED?... Brothers I Give Ones Truth Ending Denial... Last Edited by CELT1 on 03/28/2020 10:27 AM CELT1 |
CELT1
(OP) User ID: 78677992 United States 03/28/2020 11:01 AM Report Abusive Post Report Copyright Violation | |
Anonymous Coward User ID: 78666280 United States 03/28/2020 11:44 AM Report Abusive Post Report Copyright Violation | Repent Pray Then Help One Another And A Blessing Shall Come... Quoting: CELT1 Or A Curse Shall Come... But it shall come to pass, if thou wilt not hearken unto the voice of the LORD thy God, to observe to do all his commandments and his statutes which I command thee this day; that all these curses shall come upon thee, and overtake thee: What Shall It Be?... The Cleansing Continues... People have given up because faith is a vanity. We repent, and then what? We will be devoured slowly by Non Whites and utterly destroyed. If we don't repent, then we will be destroyed quickly. God's justice? What justice is there in a judge that willfully accepts false, misleading and outright malicious testimony? All Satan has to do is go before God, blatantly lie, engage in misleading accusations or even in malicious accusations, then God gives Satan full reign to do what evil he may. I heard it as a far off voice, the Dragon arguing with the Heavenly Father. In the end, the Dragon admitted that all he ever did, every accusation true, malicious, misleading or outright fraudulent, was to ensure only his children received the good things of life, and to cause as much harm as he could to the seed God planted. Then Satan, the Dragon, declared the Heavenly Father was unworthy to be chief god, because the Heavenly Father knew it from the start, but allowed the farce to continue for his own purposes. How can I have faith in such a corrupt judge? A judge who promises a restoration of all that was lost, but doesn't restore a damn thing? Our civilizations will never be restored. Our communities will never be restored. Our people will never be restored, let alone healed. All that will happen is, those that God "loves to have around", will be raised from the dead to become like the angels. That is not a restoration. What the locust has devoured, will stay devoured, as God doesn't raise us so that we may live free of Satan and Satan's children, he raises us so that we may exist as eternal eunuch slaves. Since the Heavenly Father restores nothing, I blame the Heavenly Father for all the evils that exist. Every-time one of my kind or kindred kind are mocked, beaten, robbed, enslaved, raped or murdered, it is as if the Heavenly Father did it. For his sake, we are held down, mocked, falsely accused, beaten, robbed, raped, enslaved and murdered, and what for our sake? The Heavenly Father cannot even stand to allow us one brief life of happiness, love and well doing. All of his promises are poison. They are nothing more then a reminder that when push comes to shove, when it truly matters to us, he will always side against us, even if it meanings running off and whoring with his bitter enemy Satan. I may understand the reasons why the Heavenly Father does what he does in this matter, but without a genuine restoration, it makes me repent in being formed and mourn the day of my birth. As in the final analysis, there is no real or meaningful difference between the Heavenly Father and Satan; and between Christ and AntiChrist, concerning humanity/children of Noah. They all seek to prevent humanity/Children of Noah from prospering/doing well, from marrying and procreating. Then there are people like you who say "repent, repent", and the sting of betrayal is ever the more bitter. In the end, without lying, the only things we can repent in is being formed, in being born and in existing. From the depths of the abyss, to the very throne, there is not a shred of holiness, justice or righteousness. Just hypocrisy, double standards, and ascetic tyranny. |
CELT1
(OP) User ID: 78677992 United States 03/28/2020 11:49 AM Report Abusive Post Report Copyright Violation | As It Was In Noah's Day... RAIN?... Realizing Abba Is Needed... There's Nothing Without GOD... Earth Is Special... It's A Blessing To Exist Upon Her... Repent Pray Then Help One Another If Not ye Shall Sleep Then Return Again... The Long Way Home... Here On Man's Earth... The Home Of Jesus Christ... Last Edited by CELT1 on 03/28/2020 11:51 AM CELT1 |
Anonymous Coward User ID: 78208965 United States 03/28/2020 12:25 PM Report Abusive Post Report Copyright Violation | |
CELT1
(OP) User ID: 78677992 United States 03/28/2020 02:39 PM Report Abusive Post Report Copyright Violation | Enjoy What Little Life ye Have Left Here On Earth... SAD... Seeing Another Denier... Enjoy Ye Journey Parasite... PORN?... Proving Ones Real Now... Last Edited by CELT1 on 03/28/2020 03:09 PM CELT1 |
CELT1
(OP) User ID: 78677992 United States 03/28/2020 04:23 PM Report Abusive Post Report Copyright Violation | Baton Rouge church hosts more than 1,800 people amid COVID-19 outbreak... [link to wgno.com (secure)] Pastor Tony Spell says the way to handle a pandemic is through the healing hand of Jesus. That is our command, they shall lay hands on the sick and they shall recover. Repent Pray Then Help One Another. .. Until Then Ye Prayers Are Not Heard... SIMPLE... Repentance The First Step... A Blessing Or Curse Don't Lay ye Hands Upon Anyone Until Ye Have Repented... Cursing Is A SIN... See It Now And Do It No More... SIMPLE... Showing I Make People Learn Everything... It Begins At Home... Behind Closed Doors... The Head Of The Family Is Responsible For The Teaching Of The House... It Starts With GOD... The Counting And Their ABC's... Abba Brings Children Spiritual Salvation... CELT1 |
King Triad
User ID: 73503020 United States 03/28/2020 04:30 PM Report Abusive Post Report Copyright Violation | |
CELT1
(OP) User ID: 78677992 United States 03/28/2020 04:46 PM Report Abusive Post Report Copyright Violation | This Is How People Learn The Truth... And I Feel Sorry For The Silly pope He Doesn't Even Know My Language... Yes A Blessing Or Curse... I Bless Those Staying After The Cleansing... Repent Pray Then Help One Another... Or Ye Time Is Short Upon Earth... The Cleansing Curse... CELT1 |
Frankiesfight User ID: 75147560 United States 03/28/2020 09:22 PM Report Abusive Post Report Copyright Violation | Pope Francis, in desolate St. Peter's Square, prays for end to coronavirus Quoting: CELT1 Pope Francis prayed for an end to the coronavirus pandemic on Friday in front of an empty St. Peter's Square, as Italy continues to remain one of the most impacted regions in the world. Speaking through the rain, Francis read from the Gospel during the hour-long ceremony and urged the world to view the crisis as a reminder of basic values. "My God’s blessing come down upon you as a consoling embrace,” Francis said from the steps of St. Peter's Basilica, where he normally draws tens of thousands of worshippers. “Lord, bless the world. Give health to our bodies and comfort our hearts.” [link to www.foxnews.com (secure)] So Much To Say About This... It Makes Me Smile And Cringe At The Same Time... And Old Saying... 16So they brought it, and He asked them, “Whose image is this? And whose inscription?” “Caesar’s,” they answered. 17Then Jesus told them, “Give to Caesar what is Caesar’s, and to God what is God’s.” And they marveled at Him. 18Then the Sadducees, who say there is no resurrection, came to Jesus and questioned Him:… A New Saying... Repent Pray Then Help One Another... SIMPLE The Silly Pope Prays Out In Public... It Was Said To Pray Behind Closed Doors... Give To Caesar What Is Caesar's... Give To God What He Wants... The Love Of His People And The Respect That He Deserves... Not A Damned Collection Plate... A Blessing Or A Curse... God Doesn't Listen To Sinners... The Cleansing Continues... I Just Answered The Silly popes Prayer... A Quote That Needs To Be Seen... remove this bigoted post now, you have no clue as to what the Catholic faith is about, what this blessing entailed and why it had to be public! He is the leader of a Billion Catholics, your ignorance is deafening. My Reply... Then Go Worship Him... ITALY... I Teach About YAH... Your Abba Himself... BIGOTED?... Brothers I Give Ones Truth Ending Denial... I forget how to log in it’s been so long lol. Humans are FAR too ignorant to recognize who and what they are LET ALONE find the face of their Father... they only seek his blessing when in DURESS... As the lives of humans become more technologically advanced and they live a life of convenience they forget what it’s like to cultivate life... whether that’s a relationship with another or planting a seed... only LOVE grows things.... As far as I’m concerned I’ve been watching for a VERY LONG TIME, what’s it been 8 years ago now? 8 + The numbers always tell a story.... this is the story of a humanity that lost its humanity. |
Frankiesfight User ID: 75147560 United States 03/28/2020 09:57 PM Report Abusive Post Report Copyright Violation | |
CELT1
(OP) User ID: 78677992 United States 03/28/2020 10:16 PM Report Abusive Post Report Copyright Violation | Yes And I've Led It... Welcome Back... *8*... The Man Called Christ... A Blessing Or A Curse... I Bless Those Staying... I'm The One Casting Those Cursed Into The Darkness Away... Study Bible A Tree and its Fruit …21Not everyone who says to Me, ‘Lord, Lord,’ will enter the kingdom of heaven, but only he who does the will of My Father in heaven. 22Many will say to Me on that day, ‘Lord, Lord, did we not prophesy in Your name, and in Your name drive out demons and perform many miracles?’ 23Then I will tell them plainly, ‘I never knew you; depart from Me, you workers of lawlessness!’… Repent Pray Then Help One Another Or Be Cast Out... CELT1 |
Anonymous Coward User ID: 78647367 United States 03/28/2020 10:17 PM Report Abusive Post Report Copyright Violation | Where's All The Trolls?... Make My Day... As I Shame Ye... Quoting: CELT1 Repent Pray Then Help One Another Or Stay Condemned... A Blessing Or A Curse?... I'm Tired Of The Bullshit... Judgement Day Has Arrived... What I Bless Stays... The Rest Shall Sleep After They Taste The Wrath Of GOD As A Lesson To The Ungodly... Beware I say, for you are about to reap hot coals upon your own head. You do not know of whom you pretend to speak for, but I DO. You are the one who needs to repent, for you are not about the Father's Business. For this is not the Time to condemn, but to forgive, in Love. This is the gospel of the Kingdom, not the gall you spew. |
Anonymous Coward User ID: 75147560 United States 03/28/2020 10:55 PM Report Abusive Post Report Copyright Violation | I'm Not Writing About A Virus I'm Talking About A Biological Weapon Created In A Lab Then Released By Absolute People Of Evil... Quoting: CELT1 Chinese Made... The Truth Is Coming Out As Scientific Research Is Confirmed... This Was A Planned Attack To Do Exactly What It's Doing... Mass Fear And Panic... As Death... Copied ... Good Job People As I Said I Wasn't Writing About A Virus... A finger-print protein of a Bat Sars coronavirus was uploaded to NCBI in 2018 by the Institute of Military Medicine Nanjing on January 5th, 2018 that 100% matches today's current Covid-19 envelope protein. In 2 years, the chances of this protein not undergoing mutations and matching this 2018 virus is next to statistically impossible. In several current submissios from other countries in 3 months, there have been several mutations of this envelope protien. Although Astro points out the entire Genome of 2018 is different from the 2019 December strain but are 89% similar that suggests not the exact same species. This also further indicates that the 2018 protien could have been copied over to the current strain which wouldn't happen in nature but definately happen in a lab as per Dr. Gary Ades. Head of fauna at Kadoorie Farm and Botanic Garden Dr. Gary Ades (2020), an expert in bat ecology, is adamant that the possibility of bats transmitting their coronavirus to humans is close to zero. But Wuhan's novel coronavirus is capable of transmission between humans. And the envelope protein of Wuhan seafood market pneumonia virus (QHD43418.1) & that of Bat SARS-like coronavirus (AVP78033.1) are 100% identical, based on the Basic Local Alignment Search Tool (BLAST) of NCBI (National Center for Biotechnology Information, U.S. National Library of Medicine). NCBI itself (note 1) has noted the close connection between the 2 viruses. It follows that the bat virus has undergone genetic change (either artificial or natural). Yet it is almost impossible for envelope protein to remain unaltered after natural mutation. So the only explanation left is artificial genetic modification. That's an envelope protein, not the entire genome of the source organism. This is the entire genome of the source organism which contains the sequence for that envelope protein (notice the line "isolate="bat-SL-CoVZC45""): [link to www.ncbi.nlm.nih.gov (secure)] Now run BLAST on the entire genome... It's 89.12% identical to the complete genome of 2019-nCoV. Not 100%. So yes, they're related viruses and it seems the amino acid sequence of that particular protein is conserved between 2019-nCoV and bat-SL-CoVZC45, but the entire genome is only 89% identical. Sorry to spoil your fun. Quoting: Astroshill Sorry Atro... fun isn't spoiled... in fact you helped confirm a very important statistical probability of zero entropy between the Jan 5th, 2018 envelop protein and the Dec 2019 Sars-Cov-2 strain which isn't natural. I have also confirmed this with a Harvard graduate who is working on treatments for this current outbreak and he confirms it's statistically unlikely there would be identical envelope proteins over 2 years of mutations. Here is a 2008 study from the lab in Wuhan that details step by step how they took a natural SARS-bat coronavirus and modified it into a psuedovirus using HIV inserts so it can bind to ACE2 receptors. [link to jvi.asm.org (secure)] State Key Laboratory of Virology, Wuhan Institute of Virology, Chinese Academy of Sciences, Wuhan, China1; Key Laboratory ofCell Proliferation and Differentiation of the Ministry of Education, College of Life Sciences, Peking University, Beijing, China2;CSIRO Livestock Industries, Australian Animal Health Laboratory and Australian Biosecurity Cooperative Research Center forEmerging Infectious Diseases, Geelong, Australia3; and School of Life Science, East China Normal University, Shanghai, China In this study, a human immunodeficiency virus (HIV)-basedpseudovirus system was employed to address these issues. Ourresults indicated that the SL-CoV S protein is unable to useACE2 proteins of different species for cell entry and thatSARS-CoV S protein also failed to bind the ACE2 molecule ofthe horseshoe bat,Rhinolophus pearsonii. However, when theRBD of SL-CoV S was replaced with that from the SARS-CoVS, the hybrid S protein was able to use the huACE2 for cellentry, implying that the SL-CoV S proteins are structurally andfunctionally very similar to the SARS-CoV S. These resultssuggest that although the SL-CoVs discovered in bats so far areunlikely to infect humans using ACE2 as a receptor, it remainsto be seen whether they are able to use other surface moleculesof certain human cell types to gain entry. More from the article on how the created the HIV psuedovirus to prove their thesis of human infectivity. Construction and purification of pseudoviruses.HIV-based pseudoviruseswere prepared as described previously (37). In brief, 12g each of pHIV-Luc(pNL4.3.Luc.RE-Luc) and the S-expressing plasmids (or empty vector con-trol) was cotransfected into 2106293T cells in 10-cm dishes. After 8 h, themedium was replaced with fresh medium. Supernatants were harvested at 48 hposttransfection, clarified from cell debris by centrifugation at 3,000g, andfiltered through a 0.45-m-pore-size filter (Millipore). Pseudoviruses in the cellsupernatant (4 ml) were purified by ultracentrifugation through a 20% sucrosecushion (4 ml) at 55,000gfor 60 min using a Ty90 rotor (Beckman). Thepelleted pseudoviruses were dissolved in 100l of phosphate-buffered saline(PBS) and stored at80°C in aliquots until they were used. To evaluate theincorporation of S proteins and HIV p24 into the pseudotyped viruses, 20lofpurified viruses was subjected to sodium dodecyl sulfate-polyacrylamide gel elec-trophoresis (SDS-PAGE) and Western blotting as detailed below. This virus originated in a lab, created as a bioweapon by China. Here is your smoking gun that China has been developing viral weapons of mass destruction and is using this weapon to conduct biological warfare on humanity. Weather intentionally released or accidental, China is guilty of biological weapons research and all infected countries must hold China accountable for it’s crimes against humanity. Evidence of it matching 100% Covid-19 can be found when you run the blast and results are included in this PDF. Go to this URL and look it up your self on the Viral Genome database and then on the right hand side click Run Blast and you will find many 100% matches to the current 2019 Covid-19 virus. [link to www.ncbi.nlm.nih.gov (secure)] Here is a PDF with all the info incase this gets scrubbed, download and share this PDF before it dissapears. [link to www.filedropper.com] Also GOOGLE: AVP78033.1 You will find several articles supporting this evidence such as: [link to robinwestenra.blogspot.com] The reality, this is 100% matching Covid-19's genetic make up on many uploads on NCBI and all the evidence is self-searchable on NCBI and on the web. You are under attack by a Chinese Bioweapon, here is your proof before you die from it. *Astro edit: AVP78033.1 is an envelope protein, not the entire genome of the source organism. This is the entire genome of the source organism which contains the sequence for that envelope protein (notice the line "isolate="bat-SL-CoVZC45""): [link to www.ncbi.nlm.nih.gov (secure)] Now run BLAST on the entire genome... It's 89.12% identical to the complete genome of 2019-nCoV. Not 100%. So yes, they're related viruses and it seems the amino acid sequence of that particular protein is conserved between 2019-nCoV and bat-SL-CoVZC45, but the entire genome is only 89% identical. Here's the research paper where the ZC45 strain of the virus was first described: [link to www.ncbi.nlm.nih.gov (secure)] It links to the full genetic sequence of that strain: [link to www.ncbi.nlm.nih.gov (secure)] Which in turn lists the envelope protein and links to the amino acid sequence for that protein: 26150..26377 /note="E" /codon_start=1 /product="envelope protein" /protein_id="AVP78033.1" /translation="MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV" [link to www.ncbi.nlm.nih.gov (secure)] That link gets us to "AVP78033.1" the protein this post was originally referring to. It's just one small protein of a much larger virus. It's coded for by just 227 nucleotides of the total genome which is over 29,700 nucleotides long. So, it makes up less than 1% of the total genome. In truth, the total genome is only %89.12 identical to the "bat-SL-CoVZC45" or ZC45 strain of the virus that was identified years ago. Have you seen the geometry? It is evolving via Fibonacci sequence making it perfectly compatible for the human body [link to www.researchgate.net (secure)] |
CELT1
(OP) User ID: 78677992 United States 03/29/2020 07:29 AM Report Abusive Post Report Copyright Violation | Applications of Fibonacci numbers include computer algorithms such as the Fibonacci search technique and the Fibonacci heap data structure, and graphs called Fibonacci cubes used for interconnecting parallel and distributed systems. Yes It's A Algorithm Created For Maximum Spread... A Computer Generated Virus... The GALL... bold and impudent behavior. Giving Abba's Living Light... Repent Pray Then Help One Another A Bold Demand... A Blessing Or A Curse... That's Free Will... It's Ye Choice... CELT1 |
CELT1
(OP) User ID: 78677992 United States 03/29/2020 10:50 AM Report Abusive Post Report Copyright Violation | Jesus Christ 101 Words He Shared With His Disciples... Those He Loved... People Think I Want To Rule The World... People Think I Want To Preach To The World... That's Why Ye People Have Governments... If These Are Ye Thoughts Ye Know Nothing Of Jesus Christ... Love And Respect Nothing Else... I Live Among Those I Love... Surrounded By Those That Claim To Love Their Creator... I Have Nothing To Prove To Ye... If Ye Think I Do It's Sad... Repent Pray Then Help One Another... Do This And Ye Shall Be Blessed... If Not The Curse Already Upon Ye Shall Not Be Removed... SIMPLE Last Edited by CELT1 on 03/29/2020 11:16 AM CELT1 |
CELT1
(OP) User ID: 78677992 United States 03/30/2020 08:40 AM Report Abusive Post Report Copyright Violation | |
CELT1
(OP) User ID: 78677992 United States 03/30/2020 09:44 AM Report Abusive Post Report Copyright Violation | As The Head Of Education Your Curriculum For GOD?... A Bible... A Guide Book... The First Topic... The Truth Sets Ye Free... Not A Religion... Teach About Religions... Today Religions Are Basically Closed... True... It's Family Time To Correct Yourselves And Your Children About The Evils Of Religions... Judgement Begins At Home... Judgement Is Not A Social Function... It's Not A Group Function... That's Why You've Been Called Home... Called From Those Pens... Being Gathered Up... Call This Your Rapture... CELT1 |
CELT1
(OP) User ID: 78677992 United States 03/30/2020 09:44 AM Report Abusive Post Report Copyright Violation | To All Those At The Head Of The House... As The Head Of Education Your Curriculum For GOD?... A Bible... A Guide Book... The First Topic... The Truth Sets Ye Free... Not A Religion... Teach About Religions... Today Religions Are Basically Closed... True... It's Family Time To Correct Yourselves And Your Children About The Evils Of Religions... Judgement Begins At Home... Judgement Is Not A Social Function... It's Not A Group Function... That's Why You've Been Called Home... Called From Those Pens... Being Gathered Up... Call This Your Rapture... Why Isn't This Being Played On Americas Radios?... Is This A Lie?... Last Edited by CELT1 on 03/30/2020 09:58 AM CELT1 |
CELT1
(OP) User ID: 78677992 United States 03/30/2020 03:32 PM Report Abusive Post Report Copyright Violation | Isaih 5:8-9 Woes to the Wicked 8Woe to you who add house to house and join field to field until no place is left and you live alone in the land. 9I heard the LORD of Hosts declare: “Surely many houses will become desolate, great mansions left unoccupied. CELT1 |
CELT1
(OP) User ID: 78677992 United States 03/30/2020 07:37 PM Report Abusive Post Report Copyright Violation | Woes To The Wicked And Blessings To Those I Love... I Don't Know If Chip Reads My Posts But This One He Should... His Brother Is A Preacher... He's Know Blessed To Do So... He Can Remove The Curse Of The Wicked... He Taught His Flock As They Sat In Their Cars... Let Him Know... Chip... Brother To Brother... WOW... Repent Pray Then Help One Another... It's SIMPLE... Bring Him Here To The One That's Blessed Him In The Name Of Jesus Christ... CELT1 |
CELT1
(OP) User ID: 78677992 United States 03/30/2020 10:27 PM Report Abusive Post Report Copyright Violation | People Let's Party On The Lake... Repent Pray Then Help One Another... Now People Can't Fish For Food... SAD Judgement Day Has Arrived... I'm Going To Say Again Repent Pray Then Help One Another... You Have A Curse Upon All You... Once Saved Always Saved Is Absolute Bullshit... Your Churches Are Closed... For A Damn Good Reason... Repent Pray Then Help One Another And A Blessing You Shall Receive... If Not Condemnation Is Your Punishment... Period... Your Churches Failed Ye... Your Not Saved... I'm Tired Of The Bullshit... Should I Make It Worse?... Deny This... Go Ahead... For It Won't Stop... The Law of Liberty …10Why, then, do you judge your brother? Or why do you belittle your brother? For we will all stand before God’s judgment seat. 11It is written: “As surely as I live, says the Lord, every knee will bow before Me; every tongue will confess to God.” 12So then, each of us will give an account of himself to God.… Last Edited by CELT1 on 03/30/2020 10:33 PM CELT1 |
CELT1
(OP) User ID: 78677992 United States 03/30/2020 10:36 PM Report Abusive Post Report Copyright Violation | Woes To The Wicked And Blessings To Those I Love... Quoting: CELT1 I Don't Know If Chip Reads My Posts But This One He Should... His Brother Is A Preacher... He's Now Blessed To Do So... He Can Remove The Curse Of The Wicked... He Taught His Flock As They Sat In Their Cars... Let Him Know... Chip... Brother To Brother... WOW... Repent Pray Then Help One Another... It's SIMPLE... Bring Him Here To The One That's Blessed Him In The Name Of Jesus Christ... CELT1 |
CELT1
(OP) User ID: 78677992 United States 03/31/2020 12:27 PM Report Abusive Post Report Copyright Violation | Deranged Feminist Shrieks at Seattle Christian Street Preacher During Lockdown Order Quoting: CrsCrpr “Go home! There is a stay-at-home order that you are literally (mumbles) not following!” shouts what appears to be a woman, likely named Karen. The man is apparently a street preacher and says he’s there to preach. “GO THE F*** HOME YOU ASSHOLE! I will continue screaming, would you like that? Because I’m actually finding it really, really relaxing,” she says, before the dude goes “well….” and then Karen lets loose with a blood curdling scream that you can hear echoing around the buildings on the street. [link to www.thegatewaypundit.com (secure)] Repent Pray Then Help One Another Or Stay Cursed... This Woman Is In Denial... Clearly The Truth Torments Her Into A Frenzy... As That Mouth Proved It... Good and Bad Fruit …36But I tell you that men will give an account on the day of judgment for every careless word they have spoken. 37For by your words you will be acquitted, and by your words you will be condemned.” 38Then some of the scribes and Pharisees said to Him, “Teacher, we want to see a sign from You.”… Teachers Give Examples... SIGN?... Seeing It's God Now... A SIGN CELT1 |
CELT1
(OP) User ID: 78677992 United States 03/31/2020 08:17 PM Report Abusive Post Report Copyright Violation | [link to www.dailymail.co.uk (secure)] Quoting: Anonymous Coward 78713983 Comet FIVE times the size of Jupiter is set to light up the night skies in April - and it could be brighter than Venus The comet was discovered on December 28, 2019 in the area of Ursa Major Its currently in Mars' orbit but is on its way towards the Sun and getting brighter It was spotted by the Asteroid Terrestrial-impact Last Alert System (ATLAS) If it doesn't break up it will reach its closest point to the Sun by the end of May Make NO MISTAKE THIS is WORMWOOD By The End Of April... Wormwood is mentioned seven times in the Hebrew Bible, always with the implication of bitterness.[2] The word wormwood appears several times in the Old Testament, translated from the Hebrew term לענה (la'anah, which means "curse" in Hebrew). In general, the book of Revelation is seen as a prophecy of the corruption of the Christian churches in the end times which is followed by a New Church, signified by the New Jerusalem. Repent Pray Then Help One Another Or Stay Cursed... WORMWOOD?... When Ones Real Man Walks Out Of Darkness... GALL?... Giving Abba's Living Light... Shake Rattle And ROLL... Revealing Ones Living Light... Earthquakes In Diverse Places... Repent Pray Then Help One Another Or Stay Cursed... M 6.5 - 72km W of Challis, Idaho 2020-03-31 23:52:31 (UTC)44.448°N 115.136°W10.0 km depth CHALLIS?... Christ Has Always Lived Life In Secret... Last Edited by CELT1 on 03/31/2020 08:59 PM CELT1 |
CELT1
(OP) User ID: 78677992 United States 04/01/2020 07:26 AM Report Abusive Post Report Copyright Violation | |
King Triad
User ID: 73503020 United States 04/01/2020 07:58 AM Report Abusive Post Report Copyright Violation | |