Godlike Productions - Discussion Forum
Users Online Now: 2,125 (Who's On?)Visitors Today: 720,019
Pageviews Today: 1,267,446Threads Today: 539Posts Today: 9,174
02:56 PM


Rate this Thread

Absolute BS Crap Reasonable Nice Amazing
 

Get in here Vax shills and debunk these studies and findings.

 
YouAreDreaming  (OP)

User ID: 65871117
Canada
11/05/2021 01:51 PM
Report Abusive Post
Report Copyright Violation
Re: Get in here Vax shills and debunk these studies and findings.
Great work OP!

Stay on the trail and bring the truth to those willing to listen.
 Quoting: Anonymous Coward 80199509


All we can do is try to expose the lies, share the truth and hold the line in the face of tyranny and evil. Do the right thing... be honest, helpful and rise above the mouth of madness as we ride the eye of the storm.
YouAreDreaming  (OP)

User ID: 65871117
Canada
11/05/2021 02:46 PM
Report Abusive Post
Report Copyright Violation
Re: Get in here Vax shills and debunk these studies and findings.
I just scoff at the shills, and call them Holocaust denyers. Which completely disarms them when they say "why would they want to kill everyone?"

Remember the Nazis?
 Quoting: Anonymous Coward 49545246


This is quite literally the rise of the 4th Reich and the attempt (looking quite successful at this point) of forming their new world disorder.

It's people like this shit turd Brizinski who make it clear that it's far easier to kill a million people than to control them. Parasites like this who want to control others for their own political gains are why our world is such a shithole.

Of course we have all the CFR/IMF/DAVOS/BILDERBURG lot because the are all the same group spread out into all these 'organizations' hell bent on a fucked-up technocratic dystopia where AI/Robots serve them and only them, the rest of humanity can just rot and die in their distorted perverted dream of a psychopathic Utopia. It will never happen... these fuckers die and answer to a higher power for their crimes. Guaranteed
.
Anonymous Coward
User ID: 78356799
Germany
11/05/2021 03:45 PM
Report Abusive Post
Report Copyright Violation
Re: Get in here Vax shills and debunk these studies and findings.
shillbsflagbsmeter2stfufeedtrollstupthrd
Anonymous Coward
User ID: 81094763
Hong Kong
11/05/2021 03:50 PM
Report Abusive Post
Report Copyright Violation
Re: Get in here Vax shills and debunk these studies and findings.
Great work OP!

Stay on the trail and bring the truth to those willing to listen.
 Quoting: Anonymous Coward 80199509


All we can do is try to expose the lies, share the truth and hold the line in the face of tyranny and evil. Do the right thing... be honest, helpful and rise above the mouth of madness as we ride the eye of the storm.
 Quoting: YouAreDreaming



shillbsflagbsmeter2:rere23:specialstupidSTFUfeedtroll
Hey Karen it's time for you to stop being such a shill and troll and stop spreading such bullshit and lues and stop spreading Covid and stop beiyso fucking stupid selfish and racist and just get your damn vaccine wear a mask and support BLM and stop killing so many people with your stupidity and selfishness
CrazyOldMan

User ID: 80732980
United States
11/05/2021 04:19 PM
Report Abusive Post
Report Copyright Violation
Re: Get in here Vax shills and debunk these studies and findings.
bump
Anonymous Coward
User ID: 81049627
United States
11/05/2021 04:24 PM
Report Abusive Post
Report Copyright Violation
Re: Get in here Vax shills and debunk these studies and findings.
Think again... The gene-therapy mRNA reprograms the cell to produce a viral component. It's a synthetic spike-protein sequenced in a lab by a computer and has multiple kill-points that will cause 100% mortality within 10 years for anyone who took it.

The PRION encoded in the spike-protein

The most deadly aspect of this kill-shot is the genetic sequence contains a 5 GxxxG prion motif which will be a slow-onset of neural degenerative diseases and already we are seeing a uptick in CJD or crutzfeild-jakobs disease in Phizer vaccinated patients. CJD is 100% fatal!

This has been confirmed by many people in the industry and you can also prove it yourself by running the synthetic gene sequence for this spike protein through PLAAC and the dip at 500 is the prion motif.

Here is the gene-sequence.
[link to www.uniprot.org (secure)]
>sp|P0DTC2|SPIKE_SARS2 Spike glycoprotein OS=Severe acute respiratory syndrome coronavirus 2 OX=2697049 GN=S PE=1 SV=1

MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFF​SNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIV​NNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEG​KQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLL​ALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTL​KSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVAD​YSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKL​PDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGF​NCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLT​GTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQV​AVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAG​ICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVS​MTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKT​PPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICA​QKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQ​NVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAIS​SVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLG​QSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFV​SNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFK​NHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWL​GFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT

Here is PLAAC, copy and paste the gene-sequence run it for yourself and it spikes at 500 which is the prion.
[link to plaac.wi.mit.edu]

SARS-CoV-2 Prion-Like Domains in Spike Proteins Enable Higher Affinity to ACE2
[link to www.preprints.org (secure)]

This is why it caused Lewy Body disease in the Macaque monkey studies.
SARS-CoV-2 causes brain inflammation and induces Lewy body formation in macaques
[link to www.biorxiv.org (secure)]

A video on the Prion findings...


[link to www.bitchute.com (secure)]

It's catching some attention:
Scientist sounds alarm: COVID vaccines producing symptoms of Parkinson’s, other neurodegenerative disorders
[link to www.lifesitenews.com (secure)]

Here are a couple of scientific studies on the brain lesions this is causing ie ... real brain damage.

Acute transverse myelitis following SARS-CoV-2 vaccination: a case report and review of literature

[link to www.ncbi.nlm.nih.gov (secure)]

More studies showing vaccine causing brain lesions...!!!
COVID-19 mRNA vaccination leading to CNS inflammation: a case series
[link to www.ncbi.nlm.nih.gov (secure)]
The SPIKE-PROTEIN is part of the Sars-Cov-2 Pathology!

The second deadly aspect is that the spike-protein itself is toxic and part of the Sars-Cov-2 pathology meaning it causes inflammation. We know this from research on the spike-protein itself and it is the only part of the virus that binds to IL-8 proteins in the lung that causes inflammation.

Induction of IL-8 Release in Lung Cells via Activator Protein-1 by Recombinant Baculovirus Displaying Severe Acute Respiratory Syndrome-Coronavirus Spike Proteins
[link to www.jimmunol.org (secure)]

SARS-CoV-2 spike protein induces inflammation via TLR2-dependent activation of the NF-κB pathway
[link to pubmed.ncbi.nlm.nih.gov (secure)]

The novel coronavirus’ spike protein plays additional key role in illness
[link to www.salk.edu (secure)]

SARS-CoV-2 Spike Protein Impairs Endothelial Function via Downregulation of ACE 2
[link to www.ahajournals.org (secure)]

This leads to two specific areas where death or injury can occur:

Myocartitis - Inflammation of the Heart.
Encephlatitis - Inflammation of the brain.

The other problem is our own immune systems response to our cells causing an immune-response where the cell presenting the spike-protein triggers the killer T cells to attack and kill the cell. If too many cells die this triggers a platelet response forming clots. Thrombosis or micro-thrombosis becomes and issue and this leads to heart attacks and strokes.

This is where we have the deaths that appear within 14 days of the shots for those who get the clots and die.

Of course the final death-blow comes from ADE as we know this is causing ADE in the UK/Israel as it takes 6-9 months for that problem to occur. Another slow-onset problem of this soft kill weapon.

Not to mention the death of CB8 Killer T-Cells causing a type of auto-immune disorder.

How is this not a bioweapon designed to decimate the human population?

Oh wait, someone on the TV said safe and effective (without any human trials).

Welcome to the Vaccine Holocaust of 2021... thank-you for your participation in the greatest crime against humanity ever to take place in human history.
 Quoting: YouAreDreaming



This is the most thorough compilation of vaxx info, studies, links, stories, etc in existence. Nothing has everything in one place like this:

[link to emmc2.substack.com (secure)]
Anonymous Coward
User ID: 80649250
United States
11/05/2021 04:24 PM
Report Abusive Post
Report Copyright Violation
Re: Get in here Vax shills and debunk these studies and findings.
Why would 'they' want to kill and depopulate humans? I get that question a lot. Just look at history and communism/fascism with anthropogenic disasters.
 Quoting: YouAreDreaming


A major trait of sociopaths is their weakness in judging right from wrong, good from bad, truths from lies. Think of how that description applies to a high percentage of liberals or "progressives," much less flaming leftists.

Sociopaths are at the wheel of power in today's very "lefty" America and very "lefty" world.
Anonymous Coward
User ID: 80649250
United States
11/05/2021 04:25 PM
Report Abusive Post
Report Copyright Violation
Re: Get in here Vax shills and debunk these studies and findings.
Hey Karen it's time for you to stop being such a shill and troll and stop spreading such bullshit and lues and stop spreading Covid and stop beiyso fucking stupid selfish and racist and just get your damn vaccine wear a mask and support BLM and stop killing so many people with your stupidity and selfishness
 Quoting: Anonymous Coward 81094763


lmao

Are you doing a parody of a Joseph Stalin, Adolf Hitler or Xi Jinping? How about China Joe?
me777

User ID: 80289431
Canada
11/05/2021 04:32 PM

Report Abusive Post
Report Copyright Violation
Re: Get in here Vax shills and debunk these studies and findings.
bump
Subscribe to my blog:
Exposing The Darkness
End times headline news. Research and analysis of world events in light of Bible prophecy.
[link to lionessofjudah.substack.com (secure)]
YouAreDreaming  (OP)

User ID: 65871117
Canada
11/05/2021 04:51 PM
Report Abusive Post
Report Copyright Violation
Re: Get in here Vax shills and debunk these studies and findings.
This is the most thorough compilation of vaxx info, studies, links, stories, etc in existence. Nothing has everything in one place like this:

[link to emmc2.substack.com (secure)]
 Quoting: Anonymous Coward 81049627


Great link, thanks!
Anonymous Coward
User ID: 79503607
United Kingdom
11/05/2021 04:55 PM
Report Abusive Post
Report Copyright Violation
Re: Get in here Vax shills and debunk these studies and findings.
Great work OP!

Stay on the trail and bring the truth to those willing to listen.
 Quoting: Anonymous Coward 80199509


All we can do is try to expose the lies, share the truth and hold the line in the face of tyranny and evil. Do the right thing... be honest, helpful and rise above the mouth of madness as we ride the eye of the storm.
 Quoting: YouAreDreaming



shillbsflagbsmeter2:rere23:specialstupidSTFUfeedtroll
Hey Karen it's time for you to stop being such a shill and troll and stop spreading such bullshit and lues and stop spreading Covid and stop beiyso fucking stupid selfish and racist and just get your damn vaccine wear a mask and support BLM and stop killing so many people with your stupidity and selfishness
 Quoting: Anonymous Coward 81094763


Now GLP has a VaxxTrigger!
lmao
An even stupider version of the original Trigger.
Greengirlagain

User ID: 80912507
Canada
11/05/2021 05:04 PM
Report Abusive Post
Report Copyright Violation
Re: Get in here Vax shills and debunk these studies and findings.
Wow... the shills are silent tonight, what's the matter. Promoting mass murder and crimes against humanity ringing a bell in your dimly lit conscious?

Finally figuring out that you are accomplices to mass murder and genocide of the human race?

Don't want to stand with the ones killing children, teenagers, your friends, your family with a lethal injection for profit as they roll our their new world disorder?

Are you one of those hear no evil, see no evil, speak no evil types?

Can't handle the truth?

Got denial? Cognitive Dissidence? Stockholm Syndrome? Just can't believe evil exists in this world?

There is no backing out of this now... billions have been delivered a lethal injection with a soft-kill weapon courtesy of Fauci, Gates and the Davos lot.

What a bright future for you and your kids.
 Quoting: YouAreDreaming


maybe the pro vaxxers are just tired of the whole fake attack against the vaccines. It's exhausting, what with all you vax shils working overtime.
I dont have the time or the desire to look at anything you posted, to be 100% honest. Youw ent on about spike protiens and viral components so right off the bat know you are getting your news from bunk sources.

Allt he mRNA does is instruct a few cells to create the appearance of being covid. They do not alter the cell in any other way. that cell does not go around the body acting like a virus. They just put a disguise on it. The body attacks it and neutralizes it, and in a few days any remaining mrna dies off and is gone from the body. Thats it. nothing more. There is a very very very small percentage that react badly. sure. almost everyone handled the vax just fine. anything else you posted, eh, get someone else to comb through it to point out your ignorance. i got shit to do tonight.
~ gg
YouAreDreaming  (OP)

User ID: 65871117
Canada
11/05/2021 05:13 PM
Report Abusive Post
Report Copyright Violation
Re: Get in here Vax shills and debunk these studies and findings.
Wow... the shills are silent tonight, what's the matter. Promoting mass murder and crimes against humanity ringing a bell in your dimly lit conscious?

Finally figuring out that you are accomplices to mass murder and genocide of the human race?

Don't want to stand with the ones killing children, teenagers, your friends, your family with a lethal injection for profit as they roll our their new world disorder?

Are you one of those hear no evil, see no evil, speak no evil types?

Can't handle the truth?

Got denial? Cognitive Dissidence? Stockholm Syndrome? Just can't believe evil exists in this world?

There is no backing out of this now... billions have been delivered a lethal injection with a soft-kill weapon courtesy of Fauci, Gates and the Davos lot.

What a bright future for you and your kids.
 Quoting: YouAreDreaming


maybe the pro vaxxers are just tired of the whole fake attack against the vaccines. It's exhausting, what with all you vax shils working overtime.
I dont have the time or the desire to look at anything you posted, to be 100% honest. Youw ent on about spike protiens and viral components so right off the bat know you are getting your news from bunk sources.

Allt he mRNA does is instruct a few cells to create the appearance of being covid. They do not alter the cell in any other way. that cell does not go around the body acting like a virus. They just put a disguise on it. The body attacks it and neutralizes it, and in a few days any remaining mrna dies off and is gone from the body. Thats it. nothing more. There is a very very very small percentage that react badly. sure. almost everyone handled the vax just fine. anything else you posted, eh, get someone else to comb through it to point out your ignorance. i got shit to do tonight.
 Quoting: Greengirlagain


I know, because scientific research studies that show there is a problem with the mRNA vaccine and the spike-protein it produces is part of the diseases pathology supported with fact-based medical evidence that counters your brainwashed propaganda koolaid isn't worth your time.

You just don't want to admit that you are wrong and this harmful weapon of mass destruction injected into your body is slowly silently going to kill you and everyone else you preached and coerced into taking it.

Cognitive dissonance is a bitch. The clock is ticking... tick tock... tick tock...

hourglass

Last Edited by YouAreDreaming on 11/05/2021 05:13 PM
nutmeg

User ID: 76388104
United States
11/05/2021 05:18 PM

Report Abusive Post
Report Copyright Violation
Re: Get in here Vax shills and debunk these studies and findings.
October 28, 2021. Carlsbad, California.

Vaxxed 6 year old....
Got two doses of the Moderna vax in a vaccine trial....
Then diagnosed with cancer.

There will be tough days ahead as Layla starts chemo in December. The family doesn’t know what the future holds for her cancer but they know they’ve armed her to fight COVID. It’s something the Mahoneys recommend to all parents, especially those who are hesitant.
[link to fox5sandiego.com (secure)]
countryleftypenn

User ID: 78100972
United States
11/05/2021 05:22 PM

Report Abusive Post
Report Copyright Violation
Re: Get in here Vax shills and debunk these studies and findings.
[link to www.nowtheendbegins.com (secure)]
Jesus Christ is the only way to Salvation.
1 Corinthians 1611 AV KJ Bible
Chapter 15
1 Moreover, brethren, I declare unto you the gospel which I preached unto you, which also ye have received, and wherein ye stand; 2 By which also ye are saved, if ye keep in memory what I preached unto you, unless ye have believed in vain. 3 For I delivered unto you first of all that which I also received, how that Christ died for our sins according to the scriptures; 4 And that he was buried, and that he rose again the third day according to the scriptures:
YouAreDreaming  (OP)

User ID: 65871117
Canada
11/05/2021 05:47 PM
Report Abusive Post
Report Copyright Violation
Re: Get in here Vax shills and debunk these studies and findings.
October 28, 2021. Carlsbad, California.

Vaxxed 6 year old....
Got two doses of the Moderna vax in a vaccine trial....
Then diagnosed with cancer.

There will be tough days ahead as Layla starts chemo in December. The family doesn’t know what the future holds for her cancer but they know they’ve armed her to fight COVID. It’s something the Mahoneys recommend to all parents, especially those who are hesitant.
[link to fox5sandiego.com (secure)]
 Quoting: nutmeg


I'd never subject my kid to a 'trial' of any of this frankensceince from the lunatics playing god with eugenics.

Anonymous Coward
User ID: 78468026
Belgium
11/05/2021 05:54 PM
Report Abusive Post
Report Copyright Violation
Re: Get in here Vax shills and debunk these studies and findings.
[link to www.dropbox.com (secure)]

[imgur] [link to imgur.com (secure)]
VampPatriot

User ID: 80264057
Netherlands
11/05/2021 05:57 PM

Report Abusive Post
Report Copyright Violation
Re: Get in here Vax shills and debunk these studies and findings.
Wow... the shills are silent tonight, what's the matter. Promoting mass murder and crimes against humanity ringing a bell in your dimly lit conscious?

Finally figuring out that you are accomplices to mass murder and genocide of the human race?

Don't want to stand with the ones killing children, teenagers, your friends, your family with a lethal injection for profit as they roll our their new world disorder?

Are you one of those hear no evil, see no evil, speak no evil types?

Can't handle the truth?

Got denial? Cognitive Dissidence? Stockholm Syndrome? Just can't believe evil exists in this world?

There is no backing out of this now... billions have been delivered a lethal injection with a soft-kill weapon courtesy of Fauci, Gates and the Davos lot.

What a bright future for you and your kids.
 Quoting: YouAreDreaming


maybe the pro vaxxers are just tired of the whole fake attack against the vaccines. It's exhausting, what with all you vax shils working overtime.
I dont have the time or the desire to look at anything you posted, to be 100% honest. Youw ent on about spike protiens and viral components so right off the bat know you are getting your news from bunk sources.

Allt he mRNA does is instruct a few cells to create the appearance of being covid. They do not alter the cell in any other way. that cell does not go around the body acting like a virus. They just put a disguise on it. The body attacks it and neutralizes it, and in a few days any remaining mrna dies off and is gone from the body. Thats it. nothing more. There is a very very very small percentage that react badly. sure. almost everyone handled the vax just fine. anything else you posted, eh, get someone else to comb through it to point out your ignorance. i got shit to do tonight.
 Quoting: Greengirlagain


Probably more tired from all the mental gymnastics you have to do defending liars, killers and thieves. I get it, you got your jabs and can’t handle you fucked up.
Sic Semper Tyrannis.

"FREEDOM IS SLAVERY.
IGNORANCE IS STRENGTH.
WAR IS PEACE.
STAYING APART BRINGS US TOGETHER." NWO Mantra
ruser

User ID: 77965388
United States
11/05/2021 05:57 PM
Report Abusive Post
Report Copyright Violation
Re: Get in here Vax shills and debunk these studies and findings.
You will own nothing- and be happy (just a little "tarded" is all). Fentynal will take out the rest. Mission accomplished!
ruser
CROW

User ID: 44907935
Australia
11/05/2021 06:11 PM
Report Abusive Post
Report Copyright Violation
Re: Get in here Vax shills and debunk these studies and findings.
Brilliant work my man!

Working my way through all the research youve posted.
passed it on to some people that are really in the know.
Thankyou.


CROW
Time is too long. Space is too big.
countryleftypenn

User ID: 78100972
United States
11/05/2021 06:22 PM

Report Abusive Post
Report Copyright Violation
Re: Get in here Vax shills and debunk these studies and findings.


Last Edited by countryleftypenn on 11/05/2021 06:22 PM
Jesus Christ is the only way to Salvation.
1 Corinthians 1611 AV KJ Bible
Chapter 15
1 Moreover, brethren, I declare unto you the gospel which I preached unto you, which also ye have received, and wherein ye stand; 2 By which also ye are saved, if ye keep in memory what I preached unto you, unless ye have believed in vain. 3 For I delivered unto you first of all that which I also received, how that Christ died for our sins according to the scriptures; 4 And that he was buried, and that he rose again the third day according to the scriptures:
Anonymous Coward
User ID: 80813986
Australia
11/05/2021 06:26 PM
Report Abusive Post
Report Copyright Violation
Re: Get in here Vax shills and debunk these studies and findings.
 Quoting: countryleftypenn


That guy needs a visit from Vlad the Impaler. He has said on a number of occasions that the global populations are in need of culling and now is offering solutions by predicting a return of the smallpox virus and pushing his qdot tatt.

On second thought, he may be Vlad, there is a resemblance.

Great thread OP, TY
Peach Head

User ID: 78884504
United States
11/05/2021 06:30 PM
Report Abusive Post
Report Copyright Violation
Re: Get in here Vax shills and debunk these studies and findings.
Wow... the shills are silent tonight, what's the matter. Promoting mass murder and crimes against humanity ringing a bell in your dimly lit conscious?

Finally figuring out that you are accomplices to mass murder and genocide of the human race?

Don't want to stand with the ones killing children, teenagers, your friends, your family with a lethal injection for profit as they roll our their new world disorder?

Are you one of those hear no evil, see no evil, speak no evil types?

Can't handle the truth?

Got denial? Cognitive Dissidence? Stockholm Syndrome? Just can't believe evil exists in this world?

There is no backing out of this now... billions have been delivered a lethal injection with a soft-kill weapon courtesy of Fauci, Gates and the Davos lot.

What a bright future for you and your kids.
 Quoting: YouAreDreaming


Or maybe there's already 8 billion threads discussing this topic.

yawn
 Quoting: Anonymous Coward 80151779


Yeah, not nearly enough given the gravity of the dire sitution, asshat
People who invoke "our democracy" really mean "their power." We are not now, nor have we ever been, a democracy. That's deliberate Communist word shifting. We are a constitutional republic.
Anonymous Coward
User ID: 81065053
United Kingdom
11/05/2021 06:31 PM
Report Abusive Post
Report Copyright Violation
Re: Get in here Vax shills and debunk these studies and findings.
Wow... the shills are silent tonight, what's the matter. Promoting mass murder and crimes against humanity ringing a bell in your dimly lit conscious?

Finally figuring out that you are accomplices to mass murder and genocide of the human race?

Don't want to stand with the ones killing children, teenagers, your friends, your family with a lethal injection for profit as they roll our their new world disorder?

Are you one of those hear no evil, see no evil, speak no evil types?

Can't handle the truth?

Got denial? Cognitive Dissidence? Stockholm Syndrome? Just can't believe evil exists in this world?

There is no backing out of this now... billions have been delivered a lethal injection with a soft-kill weapon courtesy of Fauci, Gates and the Davos lot.

What a bright future for you and your kids.
 Quoting: YouAreDreaming


Yes. Where is the cannabis kills mong?
Anonymous Coward
User ID: 76668108
United States
11/05/2021 06:56 PM
Report Abusive Post
Report Copyright Violation
Re: Get in here Vax shills and debunk these studies and findings.
Asking ‘why would they do this?’ is a troll tactic. Assessing motive is always speculative, and therefore a sidetracking from the facts of the matter. If you’re under attack, you have to repel the attack, not sit around wondering why it’s happening. After you’ve eliminated the threat then you can wonder why.
 Quoting: Identified Coward





WHY do victims ALWAYS ask "WHY"...?

...last words are always "WAIT"....
Anonymous Coward
User ID: 81095199
Hong Kong
11/05/2021 07:06 PM
Report Abusive Post
Report Copyright Violation
Re: Get in here Vax shills and debunk these studies and findings.
Wow... the shills are silent tonight, what's the matter. Promoting mass murder and crimes against humanity ringing a bell in your dimly lit conscious?

Finally figuring out that you are accomplices to mass murder and genocide of the human race?

Don't want to stand with the ones killing children, teenagers, your friends, your family with a lethal injection for profit as they roll our their new world disorder?

Are you one of those hear no evil, see no evil, speak no evil types?

Can't handle the truth?

Got denial? Cognitive Dissidence? Stockholm Syndrome? Just can't believe evil exists in this world?

There is no backing out of this now... billions have been delivered a lethal injection with a soft-kill weapon courtesy of Fauci, Gates and the Davos lot.

What a bright future for you and your kids.
 Quoting: YouAreDreaming


maybe the pro vaxxers are just tired of the whole fake attack against the vaccines. It's exhausting, what with all you vax shils working overtime.
I dont have the time or the desire to look at anything you posted, to be 100% honest. Youw ent on about spike protiens and viral components so right off the bat know you are getting your news from bunk sources.

Allt he mRNA does is instruct a few cells to create the appearance of being covid. They do not alter the cell in any other way. that cell does not go around the body acting like a virus. They just put a disguise on it. The body attacks it and neutralizes it, and in a few days any remaining mrna dies off and is gone from the body. Thats it. nothing more. There is a very very very small percentage that react badly. sure. almost everyone handled the vax just fine. anything else you posted, eh, get someone else to comb through it to point out your ignorance. i got shit to do tonight.
 Quoting: Greengirlagain


Probably more tired from all the mental gymnastics you have to do defending liars, killers and thieves. I get it, you got your jabs and can’t handle you fucked up.
 Quoting: VampPatriot



shillbsflagbsmeter2:rere23:specialstupidSTFUfeedtroll
Stop being so fucking stupid selfish and racist Karen and just get your damn vaccine wear a mask and support BLM and stop killing so many people with your stupidity and selfishness!
Anonymous Coward
User ID: 81095199
Hong Kong
11/05/2021 07:07 PM
Report Abusive Post
Report Copyright Violation
Re: Get in here Vax shills and debunk these studies and findings.
Brilliant work my man!

Working my way through all the research youve posted.
passed it on to some people that are really in the know.
Thankyou.


CROW
 Quoting: CROW


shillbsflagbsmeter2:rere23:specialstupidSTFUfeedtroll
Stop being so fucking stupid selfish and racist Karen and just get your damn vaccine wear a mask and support BLM and stop killing so many people with your stupidity and selfishness!
Anonymous Coward
User ID: 81095199
Hong Kong
11/05/2021 07:08 PM
Report Abusive Post
Report Copyright Violation
Re: Get in here Vax shills and debunk these studies and findings.
Great work OP!

Stay on the trail and bring the truth to those willing to listen.
 Quoting: Anonymous Coward 80199509


All we can do is try to expose the lies, share the truth and hold the line in the face of tyranny and evil. Do the right thing... be honest, helpful and rise above the mouth of madness as we ride the eye of the storm.
 Quoting: YouAreDreaming



shillbsflagbsmeter2:rere23:specialstupidSTFUfeedtroll
Hey Karen it's time for you to stop being such a shill and troll and stop spreading such bullshit and lues and stop spreading Covid and stop beiyso fucking stupid selfish and racist and just get your damn vaccine wear a mask and support BLM and stop killing so many people with your stupidity and selfishness
 Quoting: Anonymous Coward 81094763


Now GLP has a VaxxTrigger!
lmao
An even stupider version of the original Trigger.
 Quoting: Anonymous Coward 79503607


shillbsflagbsmeter2:rere23:specialstupidSTFUfeedtroll
Stop being so fucking stupid selfish and racist Karen and just get your damn vaccine wear a mask and support BLM and stop killing so many people with your stupidity and selfishness!
Anonymous Coward
User ID: 78468026
Belgium
11/05/2021 07:13 PM
Report Abusive Post
Report Copyright Violation
Re: Get in here Vax shills and debunk these studies and findings.
Think again... The gene-therapy mRNA reprograms the cell to produce a viral component. It's a synthetic spike-protein sequenced in a lab by a computer and has multiple kill-points that will cause 100% mortality within 10 years for anyone who took it.

The PRION encoded in the spike-protein

The most deadly aspect of this kill-shot is the genetic sequence contains a 5 GxxxG prion motif which will be a slow-onset of neural degenerative diseases and already we are seeing a uptick in CJD or crutzfeild-jakobs disease in Phizer vaccinated patients. CJD is 100% fatal!

This has been confirmed by many people in the industry and you can also prove it yourself by running the synthetic gene sequence for this spike protein through PLAAC and the dip at 500 is the prion motif.

Here is the gene-sequence.
[link to www.uniprot.org (secure)]
>sp|P0DTC2|SPIKE_SARS2 Spike glycoprotein OS=Severe acute respiratory syndrome coronavirus 2 OX=2697049 GN=S PE=1 SV=1

MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFF​SNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIV​NNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEG​KQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLL​ALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTL​KSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVAD​YSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKL​PDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGF​NCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLT​GTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQV​AVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAG​ICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVS​MTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKT​PPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICA​QKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQ​NVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAIS​SVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLG​QSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFV​SNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFK​NHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWL​GFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT

Here is PLAAC, copy and paste the gene-sequence run it for yourself and it spikes at 500 which is the prion.
[link to plaac.wi.mit.edu]

SARS-CoV-2 Prion-Like Domains in Spike Proteins Enable Higher Affinity to ACE2
[link to www.preprints.org (secure)]

This is why it caused Lewy Body disease in the Macaque monkey studies.
SARS-CoV-2 causes brain inflammation and induces Lewy body formation in macaques
[link to www.biorxiv.org (secure)]

A video on the Prion findings...


[link to www.bitchute.com (secure)]

It's catching some attention:
Scientist sounds alarm: COVID vaccines producing symptoms of Parkinson’s, other neurodegenerative disorders
[link to www.lifesitenews.com (secure)]

Here are a couple of scientific studies on the brain lesions this is causing ie ... real brain damage.

Acute transverse myelitis following SARS-CoV-2 vaccination: a case report and review of literature

[link to www.ncbi.nlm.nih.gov (secure)]

More studies showing vaccine causing brain lesions...!!!
COVID-19 mRNA vaccination leading to CNS inflammation: a case series
[link to www.ncbi.nlm.nih.gov (secure)]
The SPIKE-PROTEIN is part of the Sars-Cov-2 Pathology!

The second deadly aspect is that the spike-protein itself is toxic and part of the Sars-Cov-2 pathology meaning it causes inflammation. We know this from research on the spike-protein itself and it is the only part of the virus that binds to IL-8 proteins in the lung that causes inflammation.

Induction of IL-8 Release in Lung Cells via Activator Protein-1 by Recombinant Baculovirus Displaying Severe Acute Respiratory Syndrome-Coronavirus Spike Proteins
[link to www.jimmunol.org (secure)]

SARS-CoV-2 spike protein induces inflammation via TLR2-dependent activation of the NF-κB pathway
[link to pubmed.ncbi.nlm.nih.gov (secure)]

The novel coronavirus’ spike protein plays additional key role in illness
[link to www.salk.edu (secure)]

SARS-CoV-2 Spike Protein Impairs Endothelial Function via Downregulation of ACE 2
[link to www.ahajournals.org (secure)]

This leads to two specific areas where death or injury can occur:

Myocartitis - Inflammation of the Heart.
Encephlatitis - Inflammation of the brain.

The other problem is our own immune systems response to our cells causing an immune-response where the cell presenting the spike-protein triggers the killer T cells to attack and kill the cell. If too many cells die this triggers a platelet response forming clots. Thrombosis or micro-thrombosis becomes and issue and this leads to heart attacks and strokes.

This is where we have the deaths that appear within 14 days of the shots for those who get the clots and die.

Of course the final death-blow comes from ADE as we know this is causing ADE in the UK/Israel as it takes 6-9 months for that problem to occur. Another slow-onset problem of this soft kill weapon.

Not to mention the death of CB8 Killer T-Cells causing a type of auto-immune disorder.

How is this not a bioweapon designed to decimate the human population?

Oh wait, someone on the TV said safe and effective (without any human trials).

Welcome to the Vaccine Holocaust of 2021... thank-you for your participation in the greatest crime against humanity ever to take place in human history.
 Quoting: YouAreDreaming



This is the most thorough compilation of vaxx info, studies, links, stories, etc in existence. Nothing has everything in one place like this:

[link to emmc2.substack.com (secure)]
 Quoting: Anonymous Coward 81049627
Anonymous Coward
User ID: 78468026
Belgium
11/05/2021 07:15 PM
Report Abusive Post
Report Copyright Violation
Re: Get in here Vax shills and debunk these studies and findings.
 Quoting: Anonymous Coward 77094877


Great post
 Quoting: LLernmusic


[link to pubmed.ncbi.nlm.nih.gov (secure)]

Prion like domains are not inherently pathogenic. Only mutated ones are. You have prion like domains in every ACE 2 receptor.

So yeah, debunked. Insufferable arrogance combined with not knowing what you’re talking about just embarrasses you. (Directed street OP)

I am not vaxxed and don’t trust the vaccines to be safe, btw.
 Quoting: d_senti


GOOD NEWS EVEYONE

Thread: *MOLNUPIRAVIR* IS LETHAL - DNA MUTATIONS AND CANCERS - FDA WILL EUA THIS POISON FOR SURE

take the magic pill

MOLNUPIRAVIR

Thread: Covid pill "Molnupiravir" is an anagram for "Viral Prion Mu"
 Quoting: Anonymous Coward 77094877


 Quoting: Anonymous Coward 78468026





GLP