Get in here Vax shills and debunk these studies and findings.

Asking ‘why would they do this?’ is a troll tactic. Assessing motive is always speculative, and therefore a sidetracking from the facts of the matter. If you’re under attack, you have to repel the attack, not sit around wondering why it’s happening. After you’ve eliminated the threat then you can wonder why.

Think again... The gene-therapy mRNA reprograms the cell to produce a viral component. It's a synthetic spike-protein sequenced in a lab by a computer and has multiple kill-points that will cause 100% mortality within 10 years for anyone who took it.

The PRION encoded in the spike-protein

The most deadly aspect of this kill-shot is the genetic sequence contains a 5 GxxxG prion motif which will be a slow-onset of neural degenerative diseases and already we are seeing a uptick in CJD or crutzfeild-jakobs disease in Phizer vaccinated patients. CJD is 100% fatal!

This has been confirmed by many people in the industry and you can also prove it yourself by running the synthetic gene sequence for this spike protein through PLAAC and the dip at 500 is the prion motif.

Here is the gene-sequence.
[link to www.uniprot.org (secure)]
>sp|P0DTC2|SPIKE_SARS2 Spike glycoprotein OS=Severe acute respiratory syndrome coronavirus 2 OX=2697049 GN=S PE=1 SV=1

MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFF​SNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIV​NNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEG​KQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLL​ALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTL​KSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVAD​YSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKL​PDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGF​NCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLT​GTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQV​AVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAG​ICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVS​MTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKT​PPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICA​QKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQ​NVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAIS​SVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLG​QSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFV​SNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFK​NHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWL​GFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT

Here is PLAAC, copy and paste the gene-sequence run it for yourself and it spikes at 500 which is the prion.
[link to plaac.wi.mit.edu]

SARS-CoV-2 Prion-Like Domains in Spike Proteins Enable Higher Affinity to ACE2
[link to www.preprints.org (secure)]

This is why it caused Lewy Body disease in the Macaque monkey studies.
SARS-CoV-2 causes brain inflammation and induces Lewy body formation in macaques
[link to www.biorxiv.org (secure)]

A video on the Prion findings...


[link to www.bitchute.com (secure)]

It's catching some attention:
Scientist sounds alarm: COVID vaccines producing symptoms of Parkinson’s, other neurodegenerative disorders
[link to www.lifesitenews.com (secure)]

Here are a couple of scientific studies on the brain lesions this is causing ie ... real brain damage.

Acute transverse myelitis following SARS-CoV-2 vaccination: a case report and review of literature

[link to www.ncbi.nlm.nih.gov (secure)]

More studies showing vaccine causing brain lesions...!!!
COVID-19 mRNA vaccination leading to CNS inflammation: a case series
[link to www.ncbi.nlm.nih.gov (secure)]
The SPIKE-PROTEIN is part of the Sars-Cov-2 Pathology!

The second deadly aspect is that the spike-protein itself is toxic and part of the Sars-Cov-2 pathology meaning it causes inflammation. We know this from research on the spike-protein itself and it is the only part of the virus that binds to IL-8 proteins in the lung that causes inflammation.

Induction of IL-8 Release in Lung Cells via Activator Protein-1 by Recombinant Baculovirus Displaying Severe Acute Respiratory Syndrome-Coronavirus Spike Proteins
[link to www.jimmunol.org (secure)]

SARS-CoV-2 spike protein induces inflammation via TLR2-dependent activation of the NF-κB pathway
[link to pubmed.ncbi.nlm.nih.gov (secure)]

The novel coronavirus’ spike protein plays additional key role in illness
[link to www.salk.edu (secure)]

SARS-CoV-2 Spike Protein Impairs Endothelial Function via Downregulation of ACE 2
[link to www.ahajournals.org (secure)]

This leads to two specific areas where death or injury can occur:

Myocartitis - Inflammation of the Heart.
Encephlatitis - Inflammation of the brain.

The other problem is our own immune systems response to our cells causing an immune-response where the cell presenting the spike-protein triggers the killer T cells to attack and kill the cell. If too many cells die this triggers a platelet response forming clots. Thrombosis or micro-thrombosis becomes and issue and this leads to heart attacks and strokes.

This is where we have the deaths that appear within 14 days of the shots for those who get the clots and die.

Of course the final death-blow comes from ADE as we know this is causing ADE in the UK/Israel as it takes 6-9 months for that problem to occur. Another slow-onset problem of this soft kill weapon.

Not to mention the death of CB8 Killer T-Cells causing a type of auto-immune disorder.

How is this not a bioweapon designed to decimate the human population?

Oh wait, someone on the TV said safe and effective (without any human trials).

Welcome to the Vaccine Holocaust of 2021... thank-you for your participation in the greatest crime against humanity ever to take place in human history.

I've seen DHSC (UK Gov) execute the same routine when they had 1000's of women reporting menstrual issues in feb/mar/apr 2021 (how it's normal, how many women have heavy periods normally, ..)
And for strokes (awareness, signs,...)
And heart attacks (when it became known as a side-effect...)

[link to twitter.com (secure)]
DHSCgovuk: Over the next five years, we are investing £375 million into research to better understand and treat neurodegenerative diseases, such as motor neurone disease. Read more: [link to www.gov.uk (secure)] @beisgovuk @NIHRresearch @UKRI_News


<s>Perhaps you should look at the spike and amyloidosis?</s>

Here is the gene-sequence.
[link to www.uniprot.org (secure)]
>sp|P0DTC2|SPIKE_SARS2 Spike glycoprotein OS=Severe acute respiratory syndrome coronavirus 2 OX=2697049 GN=S PE=1 SV=1

MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFF​SNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIV​NNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEG​KQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLL​ALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTL​KSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVAD​YSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKL​PDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGF​NCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLT​GTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQV​AVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAG​ICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVS​MTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKT​PPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICA​QKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQ​NVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAIS​SVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLG​QSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFV​SNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFK​NHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWL​GFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT

Yeah, until you go to the cardio ward. Just talk to a trustworthy cardiologist and they'll tell you there's a huge spike in heart related problems like myocarditis and pericarditis.

Straight from the CDC's own website on slide 19 shows just how bad the second-shot is for developing myocarditis. Read that PDF, look at page 19 and this is directly from the CDC's own study hiding in plain sight. We don't see this on the news.

[link to www.cdc.gov (secure)]

But they keep the vaccine holocaust steaming on regardless of this being the most harmful and deadly vaccine in human history causing more deaths and injury than all vaccinations combined for the last 30 years. Not to mention, it doesn't fucking work like a proper vaccine as people lose protection in a very short duration of time.

2 shots for 6 months of alleged protection before boosters. Yeah right... total fraud.

It's the kill-shot we were warned about by whistleblowers like General Albert Stubblebine back in 2009.

[link to pubmed.ncbi.nlm.nih.gov (secure)]

Prion like domains are not inherently pathogenic. Only mutated ones are. You have prion like domains in every ACE 2 receptor.

So yeah, debunked. Insufferable arrogance combined with not knowing what you’re talking about just embarrasses you. (Directed street OP)

I am not vaxxed and don’t trust the vaccines to be safe, btw.

maybe the pro vaxxers are just tired of the whole fake attack against the vaccines. It's exhausting, what with all you vax shils working overtime.
I dont have the time or the desire to look at anything you posted, to be 100% honest. Youw ent on about spike protiens and viral components so right off the bat know you are getting your news from bunk sources.

Allt he mRNA does is instruct a few cells to create the appearance of being covid. They do not alter the cell in any other way. that cell does not go around the body acting like a virus. They just put a disguise on it. The body attacks it and neutralizes it, and in a few days any remaining mrna dies off and is gone from the body. Thats it. nothing more. There is a very very very small percentage that react badly. sure. almost everyone handled the vax just fine. anything else you posted, eh, get someone else to comb through it to point out your ignorance. i got shit to do tonight.

But commie Lisa Nandy says r
take the booster jab

Oh, look someone answered. Op, debunk this one? Looks like there's has more proof to it then what you posted.

ACE II is elevated in the brains of Alzheimer's patients..

[link to www.biorxiv.org (secure)]
Angiotensin-converting enzyme 2 (ACE2) is upregulated in Alzheimer’s disease brain

And I did run the PLAAC check.. as it bugged me!
Yes, indeed ACEII has a prion-like domain.