Previous Page |
|
Time to wake up GLP... nothing burgers, shills, idiots... we have proof! Tick tock... tick tock...[Updated] |
YouAreDreaming
Offer Upgrade
User ID: 77990689 Canada 03/12/2020 12:37 PM Report Abusive Post Report Copyright Violation | Time to wake up GLP... nothing burgers, shills, idiots... we have proof! Tick tock... tick tock...[Updated] A finger-print protein of a Bat Sars coronavirus was uploaded to NCBI in 2018 by the Institute of Military Medicine Nanjing on January 5th, 2018 that 100% matches today's current Covid-19 envelope protein. In 2 years, the chances of this protein not undergoing mutations and matching this 2018 virus is next to statistically impossible. In several current submissios from other countries in 3 months, there have been several mutations of this envelope protien. Although Astro points out the entire Genome of 2018 is different from the 2019 December strain but are 89% similar that suggests not the exact same species. This also further indicates that the 2018 protien could have been copied over to the current strain which wouldn't happen in nature but definately happen in a lab as per Dr. Gary Ades. Head of fauna at Kadoorie Farm and Botanic Garden Dr. Gary Ades (2020), an expert in bat ecology, is adamant that the possibility of bats transmitting their coronavirus to humans is close to zero. But Wuhan's novel coronavirus is capable of transmission between humans. And the envelope protein of Wuhan seafood market pneumonia virus (QHD43418.1) & that of Bat SARS-like coronavirus (AVP78033.1) are 100% identical, based on the Basic Local Alignment Search Tool (BLAST) of NCBI (National Center for Biotechnology Information, U.S. National Library of Medicine). NCBI itself (note 1) has noted the close connection between the 2 viruses. It follows that the bat virus has undergone genetic change (either artificial or natural). Yet it is almost impossible for envelope protein to remain unaltered after natural mutation. So the only explanation left is artificial genetic modification. That's an envelope protein, not the entire genome of the source organism. This is the entire genome of the source organism which contains the sequence for that envelope protein (notice the line "isolate="bat-SL-CoVZC45""): [ link to www.ncbi.nlm.nih.gov (secure)] Now run BLAST on the entire genome... It's 89.12% identical to the complete genome of 2019-nCoV. Not 100%. So yes, they're related viruses and it seems the amino acid sequence of that particular protein is conserved between 2019-nCoV and bat-SL-CoVZC45, but the entire genome is only 89% identical. Sorry to spoil your fun. Quoting: Astroshill *Astro edit: AVP78033.1 is an envelope protein, not the entire genome of the source organism. This is the entire genome of the source organism which contains the sequence for that envelope protein (notice the line "isolate="bat-SL-CoVZC45""): [ link to www.ncbi.nlm.nih.gov (secure)] Now run BLAST on the entire genome... It's 89.12% identical to the complete genome of 2019-nCoV. Not 100%. So yes, they're related viruses and it seems the amino acid sequence of that particular protein is conserved between 2019-nCoV and bat-SL-CoVZC45, but the entire genome is only 89% identical. Here's the research paper where the ZC45 strain of the virus was first described: [ link to www.ncbi.nlm.nih.gov (secure)] It links to the full genetic sequence of that strain: [ link to www.ncbi.nlm.nih.gov (secure)] Which in turn lists the envelope protein and links to the amino acid sequence for that protein: 26150..26377 /note="E" /codon_start=1 /product="envelope protein" /protein_id="AVP78033.1" /translation="MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV" [ link to www.ncbi.nlm.nih.gov (secure)] That link gets us to "AVP78033.1" the protein this post was originally referring to. It's just one small protein of a much larger virus. It's coded for by just 227 nucleotides of the total genome which is over 29,700 nucleotides long. So, it makes up less than 1% of the total genome. In truth, the total genome is only %89.12 identical to the "bat-SL-CoVZC45" or ZC45 strain of the virus that was identified years ago. **There is entropy between ZC45 and 2019-nCoV in the envelope region. These are synonymous mutations which do not affect the amino acid sequence, but do affect the genetic sequence. [ link to drive.google.com (secure)] If you run a BLAST on JUST the AVP78033.1 region of the COMPLETE genome you find a ton of matches north of 90% similarity between ZC45 and other strains. 2019-nCoV has 98% similarity, but NOT 100%. The envelope protein is coded by nucleotides 26150 to 26377 in the complete sequence: [ link to www.ncbi.nlm.nih.gov (secure)] Last Edited by Astromut on 03/16/2020 03:35 PM |
|
PirateMonkey
User ID: 77603110 United States 03/12/2020 12:39 PM Report Abusive Post Report Copyright Violation | Re: Time to wake up GLP... nothing burgers, shills, idiots... we have proof! Tick tock... tick tock...[Updated] STOP NOTICING 7/11 was a part time job!
Psalm 35:19 Let not them that are mine enemies wrongfully rejoice over me: neither let them wink with the eye that hate me without a cause. |
~Newton's Own~
User ID: 77801149 United States 03/12/2020 12:40 PM Report Abusive Post Report Copyright Violation | Re: Time to wake up GLP... nothing burgers, shills, idiots... we have proof! Tick tock... tick tock...[Updated] And yet they are now blaming us. Smh. A coward dies a thousand times, but the valiant need taste of death but once.
Fear cuts deeper than swords.
#Notmypresident. |
Anonymous Coward User ID: 76327418 United States 03/12/2020 12:40 PM Report Abusive Post Report Copyright Violation | Re: Time to wake up GLP... nothing burgers, shills, idiots... we have proof! Tick tock... tick tock...[Updated] |
Anonymous Coward User ID: 72173662 United States 03/12/2020 12:40 PM Report Abusive Post Report Copyright Violation | Re: Time to wake up GLP... nothing burgers, shills, idiots... we have proof! Tick tock... tick tock...[Updated] if true they need to be bombed the fuck back to the stone age. |
Anonymous Coward User ID: 78449887 United States 03/12/2020 12:40 PM Report Abusive Post Report Copyright Violation | Re: Time to wake up GLP... nothing burgers, shills, idiots... we have proof! Tick tock... tick tock...[Updated] 5* |
|
Anonymous Coward User ID: 77108467 United States 03/12/2020 12:41 PM Report Abusive Post Report Copyright Violation | Re: Time to wake up GLP... nothing burgers, shills, idiots... we have proof! Tick tock... tick tock...[Updated] if true they need to be bombed the fuck back to the stone age.
Quoting: Anonymous Coward 72173662 That will work out well for all of us |
Ricky M
Senior Forum Moderator
User ID: 71504938 United States 03/12/2020 12:41 PM
Report Abusive Post Report Copyright Violation | Re: Time to wake up GLP... nothing burgers, shills, idiots... we have proof! Tick tock... tick tock...[Updated] The chineee evil plan for world domination...
Began with a virus.
:raffing: |
Anonymous Coward User ID: 78026098 Canada 03/12/2020 12:42 PM Report Abusive Post Report Copyright Violation | Re: Time to wake up GLP... nothing burgers, shills, idiots... we have proof! Tick tock... tick tock...[Updated] It's spelled "whether" you tard. |
GonadTheBallbarian
User ID: 76338020 United States 03/12/2020 12:42 PM Report Abusive Post Report Copyright Violation | Re: Time to wake up GLP... nothing burgers, shills, idiots... we have proof! Tick tock... tick tock...[Updated] I fucking hope A1 isn't made in china. I'd rather be real and rejected than fake and accepted.
Individualism is the logical conclusion of rational political/social opinions. Leftism is the absence of any. |
Anonymous Coward User ID: 71433052 United States 03/12/2020 12:43 PM Report Abusive Post Report Copyright Violation | Re: Time to wake up GLP... nothing burgers, shills, idiots... we have proof! Tick tock... tick tock...[Updated]
if true they need to be bombed the fuck back to the stone age.
Quoting: Anonymous Coward 72173662 This right here. This is warfare plain and simple. Trump needs to wake the fuck up. |
GonadTheBallbarian
User ID: 76338020 United States 03/12/2020 12:43 PM Report Abusive Post Report Copyright Violation | Re: Time to wake up GLP... nothing burgers, shills, idiots... we have proof! Tick tock... tick tock...[Updated] Seriously though, this is fucked! I'd rather be real and rejected than fake and accepted.
Individualism is the logical conclusion of rational political/social opinions. Leftism is the absence of any. |
~Newton's Own~
User ID: 77801149 United States 03/12/2020 12:43 PM Report Abusive Post Report Copyright Violation | Re: Time to wake up GLP... nothing burgers, shills, idiots... we have proof! Tick tock... tick tock...[Updated] *poof* - It's gone Quoting: ^TrInItY^ lol. A coward dies a thousand times, but the valiant need taste of death but once.
Fear cuts deeper than swords.
#Notmypresident. |
Anonymous Coward User ID: 76176230 Mongolia 03/12/2020 12:43 PM Report Abusive Post Report Copyright Violation | Re: Time to wake up GLP... nothing burgers, shills, idiots... we have proof! Tick tock... tick tock...[Updated] Are people dropping like flies in USA? |
Anonymous Coward User ID: 78136730 03/12/2020 12:43 PM Report Abusive Post Report Copyright Violation | Re: Time to wake up GLP... nothing burgers, shills, idiots... we have proof! Tick tock... tick tock...[Updated] That’s literally one of the few post that has substance. Thanks! [ link to m.youtube.com (secure)] |
wYw User ID: 76856604 United States 03/12/2020 12:44 PM Report Abusive Post Report Copyright Violation | Re: Time to wake up GLP... nothing burgers, shills, idiots... we have proof! Tick tock... tick tock...[Updated] I told you so...... w w |
|
Anonymous Coward User ID: 77568399 United States 03/12/2020 12:45 PM Report Abusive Post Report Copyright Violation | Re: Time to wake up GLP... nothing burgers, shills, idiots... we have proof! Tick tock... tick tock...[Updated] wow, they posted an update in this 2015 article Lab-Made Coronavirus Triggers Debate The creation of a chimeric SARS-like virus has scientists discussing the risks of gain-of-function research. Nov 16, 2015 Update (March 11, 2020): On social media and news outlets, a theory has circulated that the coronavirus at the root of the COVID-19 outbreak originated in a research lab. Scientists say there is no evidence that the SARS-CoV-2 virus escaped from a lab. Ralph Baric, an infectious-disease researcher at the University of North Carolina at Chapel Hill, last week (November 9) published a study on his team’s efforts to engineer a virus with the surface protein of the SHC014 coronavirus, found in horseshoe bats in China, and the backbone of one that causes human-like severe acute respiratory syndrome [ link to www.the-scientist.com (secure)] |
~Newton's Own~
User ID: 77801149 United States 03/12/2020 12:45 PM Report Abusive Post Report Copyright Violation | Re: Time to wake up GLP... nothing burgers, shills, idiots... we have proof! Tick tock... tick tock...[Updated] Are people dropping like flies in USA?
Quoting: Anonymous Coward 76176230 Maybe not yet. We'll see how bad this is the next couple weeks. I don't think anyone knows for sure yet. A coward dies a thousand times, but the valiant need taste of death but once.
Fear cuts deeper than swords.
#Notmypresident. |
The Wizzard of Ahs!
User ID: 78170186 United States 03/12/2020 12:47 PM
Report Abusive Post Report Copyright Violation | Re: Time to wake up GLP... nothing burgers, shills, idiots... we have proof! Tick tock... tick tock...[Updated] #justtheflu
Quoting: ^TrInItY^ #justatard |
Starburne
User ID: 78604972 South Africa 03/12/2020 12:47 PM
Report Abusive Post Report Copyright Violation | Re: Time to wake up GLP... nothing burgers, shills, idiots... we have proof! Tick tock... tick tock...[Updated] "I have no special talent, I am only passionately curious." -Albert Einstein |
Anonymous Coward User ID: 76485281 United States 03/12/2020 12:47 PM Report Abusive Post Report Copyright Violation | Re: Time to wake up GLP... nothing burgers, shills, idiots... we have proof! Tick tock... tick tock...[Updated]
And yet they are now blaming us.
Smh.
Quoting: ~Newton's Own~ because the two strains used for thr chimera come from US bioweaponary. stop idiocy..US never stopped to produce illegal weapons. they even produce them straight in Israel to use them in thr middle east. Monsanto has its own facilities in Israel and produces white phosphorus and bioweapons. |
Fiestyfiddle
User ID: 78227903 United States 03/12/2020 12:47 PM
Report Abusive Post Report Copyright Violation | Re: Time to wake up GLP... nothing burgers, shills, idiots... we have proof! Tick tock... tick tock...[Updated] |
Anonymous Coward User ID: 69569518 United States 03/12/2020 12:48 PM Report Abusive Post Report Copyright Violation | Re: Time to wake up GLP... nothing burgers, shills, idiots... we have proof! Tick tock... tick tock...[Updated] The chineee evil plan for world domination...
Began with a virus.
:raffing:
Quoting: Ricky M it failed bad, as people on corona virus in America feel great [ link to nypost.com (secure)] A smiling Rick Cotton, the coronavirus-stricken head of the Port Authority, said he felt “good” Tuesday as he opened the front door of his Manhattan home to pick up a bag left on the ground. Wearing a navy blue robe tied at the waist, Cotton cracked open the door about a third of the way and picked up the white plastic bag, which had “Duane Reade by Walgreens” written on it. When asked by The Post how he felt, he smiled and said “Good” before closing the door at East 78th Street. Cotton’s wife, Elizabeth Smith, president of the Central Park Conservancy, also has been diagnosed with the bug and has been working remotely, the group said Monday. “I’m feeling good. We are looking forward to the two weeks,” she said in a brief phone interview. |
Leroux
User ID: 75463601 Canada 03/12/2020 12:48 PM Report Abusive Post Report Copyright Violation | Re: Time to wake up GLP... nothing burgers, shills, idiots... we have proof! Tick tock... tick tock...[Updated] if true they need to be bombed the fuck back to the stone age.
Quoting: Anonymous Coward 72173662 I agree ....Can never ever Trust China...EVER THESE RULES ARE STARTING TO ANNOY ME! Acts 24:15 15 And have hope toward God, which they themselves also allow, that there shall be a resurrection of the dead, both of the just and unjust.
1 John 2:22 Who is the liar? It is whoever denies that Jesus is the Christ. Such a person is the antichrist |
Anonymous Coward User ID: 55201025 United States 03/12/2020 12:49 PM Report Abusive Post Report Copyright Violation | Re: Time to wake up GLP... nothing burgers, shills, idiots... we have proof! Tick tock... tick tock...[Updated] Dr Fauci mentioned it while testifying before the house today that china didnt give them the data, they got it off the database online |
Anonymous Coward User ID: 72430464 United States 03/12/2020 12:50 PM Report Abusive Post Report Copyright Violation | Re: Time to wake up GLP... nothing burgers, shills, idiots... we have proof! Tick tock... tick tock...[Updated]
#justtheflu
Quoting: ^TrInItY^ The "Spanish" influenza pandemic of 1918–1919, which caused 50 million deaths worldwide, remains an ominous warning to public health. [ link to wwwnc.cdc.gov (secure)] “just the flu bro” |
Grove Street
User ID: 72438062 United States 03/12/2020 12:52 PM Report Abusive Post Report Copyright Violation | Re: Time to wake up GLP... nothing burgers, shills, idiots... we have proof! Tick tock... tick tock...[Updated] Dude the corona virus was so March 8th. Grove
And this is why we can't have nice things. |
Anonymous Coward User ID: 77938950 United States 03/12/2020 12:52 PM Report Abusive Post Report Copyright Violation | Re: Time to wake up GLP... nothing burgers, shills, idiots... we have proof! Tick tock... tick tock...[Updated] Are people dropping like flies in USA?
Quoting: Anonymous Coward 76176230 Yep, they're just invisible... |
Anonymous Coward User ID: 76082189 United States 03/12/2020 12:52 PM Report Abusive Post Report Copyright Violation | Re: Time to wake up GLP... nothing burgers, shills, idiots... we have proof! Tick tock... tick tock...[Updated] Dude the corona virus was so March 8th.
Quoting: Grove Street March 8th |
Anonymous Coward User ID: 78502183 United States 03/12/2020 12:52 PM Report Abusive Post Report Copyright Violation | Re: Time to wake up GLP... nothing burgers, shills, idiots... we have proof! Tick tock... tick tock...[Updated] It's spelled "whether" you tard.
Quoting: Anonymous Coward 78026098 ikr |
Anonymous Coward User ID: 78605058 United States 03/12/2020 12:53 PM Report Abusive Post Report Copyright Violation | Re: Time to wake up GLP... nothing burgers, shills, idiots... we have proof! Tick tock... tick tock...[Updated] Welcome to the terror-dome tards |
Previous Page |