Godlike Productions - Discussion Forum
Users Online Now: 1,438 (Who's On?)Visitors Today: 172,688
Pageviews Today: 309,948Threads Today: 84Posts Today: 1,925
03:43 AM


Rate this Thread

Absolute BS Crap Reasonable Nice Amazing
 

Get in here Vax shills and debunk these studies and findings.

 
YouAreDreaming
Offer Upgrade

User ID: 68536574
Canada
11/05/2021 12:50 AM
Report Abusive Post
Report Copyright Violation
Get in here Vax shills and debunk these studies and findings.
Think again... The gene-therapy mRNA reprograms the cell to produce a viral component. It's a synthetic spike-protein sequenced in a lab by a computer and has multiple kill-points that will cause 100% mortality within 10 years for anyone who took it.

The PRION encoded in the spike-protein

The most deadly aspect of this kill-shot is the genetic sequence contains a 5 GxxxG prion motif which will be a slow-onset of neural degenerative diseases and already we are seeing a uptick in CJD or crutzfeild-jakobs disease in Phizer vaccinated patients. CJD is 100% fatal!

This has been confirmed by many people in the industry and you can also prove it yourself by running the synthetic gene sequence for this spike protein through PLAAC and the dip at 500 is the prion motif.

Here is the gene-sequence.
[link to www.uniprot.org (secure)]
>sp|P0DTC2|SPIKE_SARS2 Spike glycoprotein OS=Severe acute respiratory syndrome coronavirus 2 OX=2697049 GN=S PE=1 SV=1

MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFF​SNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIV​NNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEG​KQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLL​ALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTL​KSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVAD​YSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKL​PDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGF​NCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLT​GTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQV​AVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAG​ICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVS​MTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKT​PPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICA​QKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQ​NVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAIS​SVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLG​QSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFV​SNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFK​NHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWL​GFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT

Here is PLAAC, copy and paste the gene-sequence run it for yourself and it spikes at 500 which is the prion.
[link to plaac.wi.mit.edu]

SARS-CoV-2 Prion-Like Domains in Spike Proteins Enable Higher Affinity to ACE2
[link to www.preprints.org (secure)]

This is why it caused Lewy Body disease in the Macaque monkey studies.
SARS-CoV-2 causes brain inflammation and induces Lewy body formation in macaques
[link to www.biorxiv.org (secure)]

A video on the Prion findings...


[link to www.bitchute.com (secure)]

It's catching some attention:
Scientist sounds alarm: COVID vaccines producing symptoms of Parkinson’s, other neurodegenerative disorders
[link to www.lifesitenews.com (secure)]

Here are a couple of scientific studies on the brain lesions this is causing ie ... real brain damage.

Acute transverse myelitis following SARS-CoV-2 vaccination: a case report and review of literature

[link to www.ncbi.nlm.nih.gov (secure)]

More studies showing vaccine causing brain lesions...!!!
COVID-19 mRNA vaccination leading to CNS inflammation: a case series
[link to www.ncbi.nlm.nih.gov (secure)]
The SPIKE-PROTEIN is part of the Sars-Cov-2 Pathology!

The second deadly aspect is that the spike-protein itself is toxic and part of the Sars-Cov-2 pathology meaning it causes inflammation. We know this from research on the spike-protein itself and it is the only part of the virus that binds to IL-8 proteins in the lung that causes inflammation.

Induction of IL-8 Release in Lung Cells via Activator Protein-1 by Recombinant Baculovirus Displaying Severe Acute Respiratory Syndrome-Coronavirus Spike Proteins
[link to www.jimmunol.org (secure)]

SARS-CoV-2 spike protein induces inflammation via TLR2-dependent activation of the NF-κB pathway
[link to pubmed.ncbi.nlm.nih.gov (secure)]

The novel coronavirus’ spike protein plays additional key role in illness
[link to www.salk.edu (secure)]

SARS-CoV-2 Spike Protein Impairs Endothelial Function via Downregulation of ACE 2
[link to www.ahajournals.org (secure)]

This leads to two specific areas where death or injury can occur:

Myocartitis - Inflammation of the Heart.
Encephlatitis - Inflammation of the brain.

The other problem is our own immune systems response to our cells causing an immune-response where the cell presenting the spike-protein triggers the killer T cells to attack and kill the cell. If too many cells die this triggers a platelet response forming clots. Thrombosis or micro-thrombosis becomes and issue and this leads to heart attacks and strokes.

This is where we have the deaths that appear within 14 days of the shots for those who get the clots and die.

Of course the final death-blow comes from ADE as we know this is causing ADE in the UK/Israel as it takes 6-9 months for that problem to occur. Another slow-onset problem of this soft kill weapon.

Not to mention the death of CB8 Killer T-Cells causing a type of auto-immune disorder.

How is this not a bioweapon designed to decimate the human population?

Oh wait, someone on the TV said safe and effective (without any human trials).

Welcome to the Vaccine Holocaust of 2021... thank-you for your participation in the greatest crime against humanity ever to take place in human history.
YouAreDreaming  (OP)

User ID: 68536574
Canada
11/05/2021 01:02 AM
Report Abusive Post
Report Copyright Violation
Re: Get in here Vax shills and debunk these studies and findings.
Why would 'they' want to kill and depopulate humans? I get that question a lot. Just look at history and communism/fascism with anthropogenic disasters.

[link to en.wikipedia.org (secure)]

The group behind it is the globalists who want to control this planet and it's resources. The 4th reich fascists of our modern age. Klaus Scwab, Bill Gates, Fauci, Soros, Rockafeller and all their mindless minions of evil.

They boast about it in their plandemic drills:

John Hopkins Dark Winter (2001).
Rockafeller Lockstep (2010 ).
John Hopkins SPARS (2017)
John Hopkins Event 201

They lay out their plans in plain sight:
Agenda 21.
Agenda 2030.
The Great Reset.
Cyber Polygon.

And you useful idiots, uneducated plebs fall for their lies time and time again and are now accomplices in this great act of evil and maleficence by believing 'the big lie' and not using common-sense and critical thinking. Many of you support Gates like he's some god, yet he's boasted about depopulation through vaccines, his father was part of Planned Parenthood, he admits in his 'research' they are injecting GMO (genetically modified organisms) directly into children's veins. He was a good pal with Jeffery Epstein and likes those panda eyes.

YouAreDreaming  (OP)

User ID: 68536574
Canada
11/05/2021 01:15 AM
Report Abusive Post
Report Copyright Violation
Re: Get in here Vax shills and debunk these studies and findings.
Wow... the shills are silent tonight, what's the matter. Promoting mass murder and crimes against humanity ringing a bell in your dimly lit conscious?

Finally figuring out that you are accomplices to mass murder and genocide of the human race?

Don't want to stand with the ones killing children, teenagers, your friends, your family with a lethal injection for profit as they roll our their new world disorder?

Are you one of those hear no evil, see no evil, speak no evil types?

Can't handle the truth?

Got denial? Cognitive Dissidence? Stockholm Syndrome? Just can't believe evil exists in this world?

There is no backing out of this now... billions have been delivered a lethal injection with a soft-kill weapon courtesy of Fauci, Gates and the Davos lot.

What a bright future for you and your kids.
Anonymous Coward
User ID: 80151779
United States
11/05/2021 01:16 AM
Report Abusive Post
Report Copyright Violation
Re: Get in here Vax shills and debunk these studies and findings.
Wow... the shills are silent tonight, what's the matter. Promoting mass murder and crimes against humanity ringing a bell in your dimly lit conscious?

Finally figuring out that you are accomplices to mass murder and genocide of the human race?

Don't want to stand with the ones killing children, teenagers, your friends, your family with a lethal injection for profit as they roll our their new world disorder?

Are you one of those hear no evil, see no evil, speak no evil types?

Can't handle the truth?

Got denial? Cognitive Dissidence? Stockholm Syndrome? Just can't believe evil exists in this world?

There is no backing out of this now... billions have been delivered a lethal injection with a soft-kill weapon courtesy of Fauci, Gates and the Davos lot.

What a bright future for you and your kids.
 Quoting: YouAreDreaming


Or maybe there's already 8 billion threads discussing this topic.

yawn
YouAreDreaming  (OP)

User ID: 68536574
Canada
11/05/2021 01:21 AM
Report Abusive Post
Report Copyright Violation
Re: Get in here Vax shills and debunk these studies and findings.
Wow... the shills are silent tonight, what's the matter. Promoting mass murder and crimes against humanity ringing a bell in your dimly lit conscious?

Finally figuring out that you are accomplices to mass murder and genocide of the human race?

Don't want to stand with the ones killing children, teenagers, your friends, your family with a lethal injection for profit as they roll our their new world disorder?

Are you one of those hear no evil, see no evil, speak no evil types?

Can't handle the truth?

Got denial? Cognitive Dissidence? Stockholm Syndrome? Just can't believe evil exists in this world?

There is no backing out of this now... billions have been delivered a lethal injection with a soft-kill weapon courtesy of Fauci, Gates and the Davos lot.

What a bright future for you and your kids.
 Quoting: YouAreDreaming


Or maybe there's already 8 billion threads discussing this topic.

yawn
 Quoting: Anonymous Coward 80151779


Yep... let the information flow, people are being murdered on an industrial scale thanks to this event.
Lord Earl of Greywater

User ID: 80857430
Romania
11/05/2021 01:22 AM
Report Abusive Post
Report Copyright Violation
Re: Get in here Vax shills and debunk these studies and findings.
EXCLUSIVE – Vaccinated people accounted for 82% of Covid-19 deaths, 69% of hospitalisations & 54% of cases in September according to official figures
BY THE EXPOSÉ ON OCTOBER 14, 2021

[link to theexpose.uk (secure)]
Wankenit
Anonymous Coward
User ID: 80151779
United States
11/05/2021 01:25 AM
Report Abusive Post
Report Copyright Violation
Re: Get in here Vax shills and debunk these studies and findings.
Wow... the shills are silent tonight, what's the matter. Promoting mass murder and crimes against humanity ringing a bell in your dimly lit conscious?

Finally figuring out that you are accomplices to mass murder and genocide of the human race?

Don't want to stand with the ones killing children, teenagers, your friends, your family with a lethal injection for profit as they roll our their new world disorder?

Are you one of those hear no evil, see no evil, speak no evil types?

Can't handle the truth?

Got denial? Cognitive Dissidence? Stockholm Syndrome? Just can't believe evil exists in this world?

There is no backing out of this now... billions have been delivered a lethal injection with a soft-kill weapon courtesy of Fauci, Gates and the Davos lot.

What a bright future for you and your kids.
 Quoting: YouAreDreaming


Or maybe there's already 8 billion threads discussing this topic.

yawn
 Quoting: Anonymous Coward 80151779


Yep... let the information flow, people are being murdered on an industrial scale thanks to this event.
 Quoting: YouAreDreaming


My apologies I forgot some people still give a fuck. Apathy is a bitch. Don't take the black pill. It ruins your life. Anyways have a good night.
YouAreDreaming  (OP)

User ID: 68536574
Canada
11/05/2021 01:29 AM
Report Abusive Post
Report Copyright Violation
Re: Get in here Vax shills and debunk these studies and findings.
My apologies I forgot some people still give a fuck. Apathy is a bitch. Don't take the black pill. It ruins your life. Anyways have a good night.
 Quoting: Anonymous Coward 80151779


Yes, some of us still have love for this world and humanity.
REaliZe

User ID: 80781908
United States
11/05/2021 01:32 AM

Report Abusive Post
Report Copyright Violation
Re: Get in here Vax shills and debunk these studies and findings.
Great thread.
There's. A. H0le. In. The. Sky.
Anonymous Coward
User ID: 80151779
United States
11/05/2021 01:37 AM
Report Abusive Post
Report Copyright Violation
Re: Get in here Vax shills and debunk these studies and findings.
My apologies I forgot some people still give a fuck. Apathy is a bitch. Don't take the black pill. It ruins your life. Anyways have a good night.
 Quoting: Anonymous Coward 80151779


Yes, some of us still have love for this world and humanity.
 Quoting: YouAreDreaming


Heh. Believe it or not once I did too. Mental breakdowns are a bitch. Want some advice? Don't have one. I'm basically as insane as the Joker without wanting to kill everyone. Or is the Joker really just so sane he looks insane? Well that's a philosophical debate for another time.

Anyways I'm really gone this time. I think. Insomnia is annoying. Have a good night. Really.

hf
Anonymous Coward
User ID: 77311004
United States
11/05/2021 01:41 AM
Report Abusive Post
Report Copyright Violation
Re: Get in here Vax shills and debunk these studies and findings.
The black pill is the white pill. Modern civilization is evil, humans are amazing.
YouAreDreaming  (OP)

User ID: 68536574
Canada
11/05/2021 02:58 AM
Report Abusive Post
Report Copyright Violation
Re: Get in here Vax shills and debunk these studies and findings.
Great thread.
 Quoting: REaliZe


Hope the info helps although a little to late imo... evil may have won this round.
Loila

User ID: 75225479
Australia
11/05/2021 03:05 AM

Report Abusive Post
Report Copyright Violation
Re: Get in here Vax shills and debunk these studies and findings.
It's a synthetic. Bit like asbestos.. a killer..
YouAreDreaming  (OP)

User ID: 68536574
Canada
11/05/2021 03:06 AM
Report Abusive Post
Report Copyright Violation
Re: Get in here Vax shills and debunk these studies and findings.
It's a synthetic. Bit like asbestos.. a killer..
 Quoting: Loila


An abomination towards nature indeed...
Ivar Mac Tynn

User ID: 81092641
Germany
11/05/2021 03:11 AM

Report Abusive Post
Report Copyright Violation
Re: Get in here Vax shills and debunk these studies and findings.
Anonymous Coward
User ID: 77094877
11/05/2021 11:07 AM
Report Abusive Post
Report Copyright Violation
Re: Get in here Vax shills and debunk these studies and findings.
[imgur] [link to imgur.com (secure)]
Anonymous Coward
User ID: 77094877
11/05/2021 11:09 AM
Report Abusive Post
Report Copyright Violation
Re: Get in here Vax shills and debunk these studies and findings.
Thread: Chromosome 8
Trashcanman2

User ID: 80276927
United States
11/05/2021 11:11 AM
Report Abusive Post
Report Copyright Violation
Re: Get in here Vax shills and debunk these studies and findings.
Thanks for posting again.
This should be perma-pinned until the plandemic is over.
Trashcanman2
Anonymous Coward
User ID: 78276863
Sweden
11/05/2021 11:14 AM
Report Abusive Post
Report Copyright Violation
Re: Get in here Vax shills and debunk these studies and findings.
What a interesting cross word puzzle, OP!
LLernmusic

User ID: 55201025
United States
11/05/2021 11:17 AM

Report Abusive Post
Report Copyright Violation
Re: Get in here Vax shills and debunk these studies and findings.
Great post
Anonymous Coward
User ID: 80866536
United States
11/05/2021 11:21 AM
Report Abusive Post
Report Copyright Violation
Re: Get in here Vax shills and debunk these studies and findings.
The irony is those minions that joined forces with the illuminated to do all the bad deeds, actually think they get to survive this crime against humanity...... speaking straight to all of them, you got your reward... for trafficking, handling, muleing, you got your hot rod with Illuminati rims, and some cash in hand, and your fate is just like that of the child you delivered...... you will be eliminated ........
Anonymous Coward
User ID: 80256772
United States
11/05/2021 11:25 AM
Report Abusive Post
Report Copyright Violation
Re: Get in here Vax shills and debunk these studies and findings.
OP... YOU TOOK THE VAXX, RIGHT?

OP... NOW YOU SCARED?

OP... P-PAR RECEPTOR, I.E. SR9009 & GW501506, ALMOST INSTANTLY CURE YOUR TWO ISSUES E.G. CARDIOVASCULAR AND BRAIN.

JUST TREAT YOURSELF, YOUR LOVED ONES AND

MOVE ALONG...

YOU, AN OBVIOUS RESEARCHER, ARE LOOKING FOR AN EXCUSE TO BLAME AND HOLD SOMEONE ACCOUNTABLE...

JUST TREAT YOURSELF... "MAKE A CURE" AND CURE YOUR LOVED ONES.

PRETTY EASY, NON-VAXXER HERE, 2 OR 3 TIMES SPIKE PROTIEN INFECTED AND 1ST INFECTION WAS HELL, 2ND BARELY NOTICEABLE AND THE 3RD IS A BLESSING AS IT PROVES MY ANTIBODIES ARE STRONG AND I BARELY FELT ANY COVID SYMPTOMS.

*** THE VAXXED, ARE INFECTING, AND KILLING THE UNVAXXED THRU THE SPIKE ***

*** LET THE VAXX DIE ***

*** LET THE DEAD BURY THE DEAD ***

PEACE BE UPON YOU RESEARCHER, BUT YOU ARE LOOKING THE WRONG WAY... DO NOT BLAME, FIND THE CURE! PEACE!!!
d_senti

User ID: 80631376
United States
11/05/2021 11:26 AM
Report Abusive Post
Report Copyright Violation
Re: Get in here Vax shills and debunk these studies and findings.
Great post
 Quoting: LLernmusic


[link to pubmed.ncbi.nlm.nih.gov (secure)]

Prion like domains are not inherently pathogenic. Only mutated ones are. You have prion like domains in every ACE 2 receptor.

So yeah, debunked. Insufferable arrogance combined with not knowing what you’re talking about just embarrasses you. (Directed street OP)

I am not vaxxed and don’t trust the vaccines to be safe, btw.

Last Edited by d_senti on 11/05/2021 11:27 AM
Anonymous Coward
User ID: 77094877
11/05/2021 11:30 AM
Report Abusive Post
Report Copyright Violation
Re: Get in here Vax shills and debunk these studies and findings.
Great post
 Quoting: LLernmusic


[link to pubmed.ncbi.nlm.nih.gov (secure)]

Prion like domains are not inherently pathogenic. Only mutated ones are. You have prion like domains in every ACE 2 receptor.

So yeah, debunked. Insufferable arrogance combined with not knowing what you’re talking about just embarrasses you. (Directed street OP)

I am not vaxxed and don’t trust the vaccines to be safe, btw.
 Quoting: d_senti


GOOD NEWS EVEYONE

Thread: *MOLNUPIRAVIR* IS LETHAL - DNA MUTATIONS AND CANCERS - FDA WILL EUA THIS POISON FOR SURE

take the magic pill

MOLNUPIRAVIR

Thread: Covid pill "Molnupiravir" is an anagram for "Viral Prion Mu"
VenusRose

User ID: 53196900
Romania
11/05/2021 11:32 AM
Report Abusive Post
Report Copyright Violation
Re: Get in here Vax shills and debunk these studies and findings.
thx for the great post.

i have a real life friend who suffered from acute myelitis
Anonymous Coward
User ID: 80875178
United States
11/05/2021 11:46 AM
Report Abusive Post
Report Copyright Violation
Re: Get in here Vax shills and debunk these studies and findings.
Asking ‘why would they do this?’ is a troll tactic. Assessing motive is always speculative, and therefore a sidetracking from the facts of the matter. If you’re under attack, you have to repel the attack, not sit around wondering why it’s happening. After you’ve eliminated the threat then you can wonder why.
WokWook

User ID: 80512863
United States
11/05/2021 12:01 PM

Report Abusive Post
Report Copyright Violation
Re: Get in here Vax shills and debunk these studies and findings.
This shit contagious or not?
GWORLEY

User ID: 81067806
United States
11/05/2021 12:11 PM
Report Abusive Post
Report Copyright Violation
Re: Get in here Vax shills and debunk these studies and findings.
Also on the British report:

"The proportion of all people who were admitted to hospital within 14 days of a laboratory confirmed COVID-19 positive test has declined, from 12% in the week ending 31 January 2021, to 3% in the most recent week ending 26 September 2021."

So the vaxx is working. Far fewer hospitalizations.

Last Edited by GWORLEY on 11/05/2021 12:13 PM
YouAreDreaming  (OP)

User ID: 65871117
Canada
11/05/2021 12:16 PM
Report Abusive Post
Report Copyright Violation
Re: Get in here Vax shills and debunk these studies and findings.
This shit contagious or not?
 Quoting: WokWook


The transmission of the spike-protein shedding from the vax poses a risk to unvaccinated because of transmissible spongiform encephalopathies (TSE) which puts everyone at risk of prion disease.

Also the pathological effect of the spike-protein can potentially affect the health of the unvaccinated as we've seen babies die from breastfeeding from vaccinated mothers. Unvaccinated woman and teens complaining of menstral irregularities when exposed to vaxxed.

Prion disease is a slow onset, so it can lurk for 10 years although we are seeing rapid onset with the vaxxed because they are producing trillions of spike-proteins like a big spike-protein factory.

Your Crazy Mom

User ID: 80623984
United States
11/05/2021 12:23 PM

Report Abusive Post
Report Copyright Violation
Re: Get in here Vax shills and debunk these studies and findings.
bump
YouAreDreaming  (OP)

User ID: 65871117
Canada
11/05/2021 12:24 PM
Report Abusive Post
Report Copyright Violation
Re: Get in here Vax shills and debunk these studies and findings.
Also on the British report:

"The proportion of all people who were admitted to hospital within 14 days of a laboratory confirmed COVID-19 positive test has declined, from 12% in the week ending 31 January 2021, to 3% in the most recent week ending 26 September 2021."

So the vaxx is working. Far fewer hospitalizations.
 Quoting: GWORLEY


Yeah, until you go to the cardio ward. Just talk to a trustworthy cardiologist and they'll tell you there's a huge spike in heart related problems like myocarditis and pericarditis.

Straight from the CDC's own website on slide 19 shows just how bad the second-shot is for developing myocarditis. Read that PDF, look at page 19 and this is directly from the CDC's own study hiding in plain sight. We don't see this on the news.

[link to www.cdc.gov (secure)]

But they keep the vaccine holocaust steaming on regardless of this being the most harmful and deadly vaccine in human history causing more deaths and injury than all vaccinations combined for the last 30 years. Not to mention, it doesn't fucking work like a proper vaccine as people lose protection in a very short duration of time.

2 shots for 6 months of alleged protection before boosters. Yeah right... total fraud.

It's the kill-shot we were warned about by whistleblowers like General Albert Stubblebine back in 2009.





GLP